Nct U Smut - Tumblr Posts
Baby Don't Like It
MARK LEE X BLACK FEM.READER
Genre: Idol Boyfriend AU, Valentine's Day,
Warnings: Suggestive, Mature, Potential Spelling errors.
A/n: This is the Valentine's treat, the before obviously! Have fun, it'll be a while before I wite part 2. I never pre-plan these. I always write what I feel in the moment, so just wait a while please! Thank you!
A/n pt.2: In this fanfic, I used Mark's "White-blueish" hair. If you went to a 2022-23 Nct tour, you know what Im talking about. Just to stop any confusion cause I know now homeboy has Blonde at the moment ♡
Wordcount: About 800 words?
Part One:Here
Part Two: Highway to Heaven
Part three: Angel
Today is Valentine's day, you shared the day with your angel of a boyfriend. The both of you in his apartment, sitting at the kitchen Island you watched as he baked cookies for the both of you. He talked about his day at work before the two of you met up.
His cute voice rambling about many things you could get lost in and listen to for hours. He eventually stopped, and looked up at you to see you watching him intensity. Realizing he'd been going on and on he stayed quiet for a bit before speaking once more.
"—Anyway, enough about me and my day. Tell me about yours gorgeous", he said adjusting his glasses.
You smiled finding him cute, "Nothing too interesting kitten, it was pretty boring." He gazes at you then continues kneading the cookie dough. "I'm sorry Y/n, I hope it gets better."
"Oh it already gotten better Mark, You’re celebrating Valentine's day with me. I really appreciate it!"
Mark snickers looking up past his lenses, "Anything for you, but...Kitten?" He questioned as he looked at you from the other side kitchen island. "I thought it'd be cute", you admitted, "Don't like it? I can stop."
"No, not at all", He says looking down at the bowl. His cheeks on fire, "I like it..No— I love it actually. It's just you suprised me." You nod, confirming that he was comfortable with it. Hopping down from the stool you walk your way over to Mark.
"Want to let me help?"
"What no, just sit and look beautiful. Im almost done." You make space for yourself shifting into the space between the counter and Mark. "Let me help!" you exclaim wrapping your arms around his neck. He laughs, "Y/n, babe Im almost done. All I have to do is put the dough on the pan."
"Then let me do that!"
Mark lets out that cute laugh of his, "Jagiya..You're in my way."
"I know Mark", you confessed as you playfully puckered your lips out to him. His lips soon meet yours, softly pressing to yours he sighs against them. Pulling away he snakes an arm around your waist gazing down at you.
"Mark Lee.."
"Yes?"
"You look fine as fuck today." Mark flushes, revealing a cutesy hue across his face. "Thank you Jagi, you look stunning today too." Mark bends down to kiss you once more, the rim of his glasses touching your face. He attempts to pull away but your slender fingers manage to get a grasp of his collar keeping him close to your face.
"I have a question Mark."
"Ask me."
"Do you perhaps...Have anything planned for tonight?" Marks eyes glued to your lips, soon your back touching the counter behind you. "I do", he said eyes now locked onto yours.
"Im ready to give my all to you Y/n", Mark stated flustered. You teeth bitting your bottom lip, while tracing your fingers along the buttons on his collared shirt. "Mark."
"Mhm?" You pulled away watching his face carefully,"You do know...We don't have you if you're not ready, right?"
Surprised, he'd thought you'd catch the hint that he was more than ready..but he was always kind of 'Naive-ish'. One thing about you and Mark's relationship, was that Mark was a virgin. This didn't mean anything to you, you didn't mind at all. He was a bit shy to tell you though, not having any experience made him a bit nervous to confess. Especially when you told him you'd been with your ex in a previous relationship.
"Wouldn't you perfer someone with experience?", He asked. You shrugged expressing to him, it didn't matter to you whether he had been with an ex or not. All that mattered was that if they were clean and he was ready; and that Mark was. Before anything the both of you took tests and shared results, showing eachother you were clean.
You communicate to him that whenever he was ready for his first time, it was up to him. He was glad you'd let him take his time, and in the meantime he'd return the favor by slowly unraveling, showcasing his sensual skills. From making out, to grinding, to fingering... Nothing past that until now.
"Jagiya, What better time than now?", he states leaning in. Mark places his hands on the back on your thighs, hoisting you up onto the counter. The action made you flustered, you hid your face a little behind your hand. "W-What about the cookies you were just baking?"
Mark chuckles glancing at your thighs then up at your covered face. His hands on either sides of you as you sat on the counter. He tilted his head, as his brow, amused. "I WAS trying to bake, but you got in my way and seduced me."
"Well I wouldn't say seduced." You attempt to play innocent lifting your leg to rub against his thigh. "Kitten, I haven't even gotten started."
Mark softly stroking your leg, chuckling lightly. "Why'd you suddenly bring up baking when you were just in the middle of flirting with me? Did I make you nervous when I lifted you up and sat you on the counter?"
You squint your eyes turning away, "What is this? An interrogation? So many questions.."
"Mark..", you sighed. You yelped feeling teeth nip at your skin. Your boyfriend pulled away showcasing a bruise. You gasped, "Mark! You know I love wearing skirts and dresses!"
Mark teases you, "Oh yes..An interrogation, you seem nervous. Should I hook you up to a lie detector?" Marks hands make their way to your thighs, slightly separating them. His white hair brushing against your skin as he leans down to kiss your thighs.
"Oh no! I'm sorry! I should've asked!", He panicked. You pulled him close, gently kissing his flushed cheeks. "Im just kidding Kitten."
He calmed down, softly exhaling. Slightly pulling up your flowy dress mid thigh, "You can leave another one Mark." Mark smiles,"Maybe just one more for the time being..I wouldn't want everyone to see."
Mark grips your thighs once more, slowing spreading them. Kissing them while keeping his eyes on you. You slightly hide your face having his glares were making you nervous.
The softness of his cute lips against your plump thighs making you hungrier for his love. "Mark–"
"Hm?" He hums against your skin. "Is this really okay for me to be on this counter?"
He pauses his little teasing-like kisses looking at you, "Mm..Yes why?"
"Well, you were just baking here— and I uh.."
Mark blinks rapidly, "So..Is this your suggestion to move to the bedroom?" You gasp, seeing as it did sound that way. "Oh..I didn't mean it that way! It came out that way." Mark only smiled, delicately pushing you down on the counter. Your back now against the cool material causing you to shiver.
Mark locking your wrists down to the cool pavement. "Y/n..", Mark quietly whispers as he look down at you. "Hm?" He smiles, his expression a little wry. "I want to be honest, Im slightly nervous." You watched his face, giggling.
"What are you laughing at?" He frowned.
"You. I know, I'm sorry Mark. You're cute."
Pulling yourself up you hop down from the counter, grabbing Mark's hands. "Mark In all seriousness, It's alright, I was there once too." You placed his hands on your waist, pulling him close.
"You somehow make me feel confident."
"That's good—", You say standing on your toes. You gently kiss Mark's adam's apple watching him flustered in dismay. "Confidence is key."
Soon before you know it, you're thrown up and over Mark's shoulders. The entire action catching you off guard, though you didn't complain. Mark, effortlessly lifting hoisting you up and about was really attractive.
"Ah! Mark!", you laugh.
"You're really dangerous, you know that?" Mark asks as he begins to walk. You giggle, placing your hand upon his shoulder. "Is that a good thing? Or a bad one?", you tease.
"A good thing, A wonderful thing, you beautiful Minx."
"Mark!", you playfully hit his shoulder. Mark chuckles enjoying the view beside him.
"Hold on to me, we're going up stairs." Hearing this only made you more excited to experience the long night you had ahead of you.
"Hurry up then", you breathe hungrily.
Mark smiles, glad to know you're just as excited as him.
"Of course love, besides I still have to give you the rest of your Valentine's Gift."
Written May 11th.
(I know its mothers day but, I had this in the drafts for a while so, here you go!)
Angel
Mark Lee X Black.FemReader
Genre: Aftercare/Morning after, Valentine's Day, Idol Boyfriend AU.
Warnings: Suggestive, Mature, Sex, Potential Spelling Errors.
A/n: Alright, Here is the cute and flirty aftercare, I know I posted this before the Seggs part. Yeah sorry, I want it to be spicy 🤧 Anyway enjoy! I also Use Mark's Korean name 'Minhyung' and shorten it to 'Min' so no confusion.
Wordcount: 800
Part One: Baby Dont Like it
Part Two: Highway to Heaven
Part Three: Here
Light giggles heard into the wee hours of the morning. Your legs around your Valentine's waist, straddling him. You looked down at him from above. Holding his hands down at his side. The both of you, naked and fresh out of the shower.
Tiredness washing over him,"I take it..I did a well?" Mark asked looking up at you. Seeing you in nothing but his T-shirt was something he'd never imagine would come true.
"Mark, Kitten– you did an amazing job."
Your boyfriend, sliding his warm hands along your thighs. His thumbs gently rubbing your skin in tiny cirles. "I know you already answered me the first time...but are you sure you're okay Y/n?"
A smile spreading across your face as you leaned down. Your hands cupping Marks cute face a such, topping it off with a little kiss to his nose. "I'm alright Mark. I promise."
"Good, I just wanted to make sure." You're boyfriend smiles sitting up straight with you still straddling him. His hands slowly creeping up from your thigh, under your shirt and to your waist. The sudden and swift feeling of Mark's hot hands sending shivers up your spine.
"I like this..", Mark says looking up at you.
Your hands resting on your boyfriend's shoulders. "Like what?" Tugging on the shirt you're wearing, messing with you a little. "You in nothing but my shirt", he admits.
"Ooh, I see. What about when I take It off?"
Mark wrinkles his nose, "There should be no suprise on how I feel about seeing you naked. You felt it all night, didn't you?"
You smiled, recalling the events, then about how hard you'd been clinging to your boyfriend.
"Speaking of which– I'm err..Sorry about those scratches Kitten", you apologize.
Mark laughes paying them no mind. Looking at the now inflamed scratchs on his biceps, feeling the burning sensation from the ones on his back.
"Oh please, I like them. They're like my little trophy scars."
"They don't hurt?"
"No, just burn a little–", he pauses, lowering his voice just a little. "It's nothing to worry about, I should get used to it."
"Huh? Why? How come?"
"Well..I do plan on getting more. A collection of these beautiful scars hm? What do you think Y/n?"
Suddenly, being lifted and put on your back. Mark now on top of you, catching you by surprise. You attempt to hide your face with your hand but fail because of Mark locking fingers with yours.
That coy smile as he looked down at your restricted form. "You're incredibly shy whenever I do something you seem to really love, hm?" Your breath hitched, heart racing, now your eyes avoiding his contact; this boyfriend of yours was catching on to your little habits.
"M-Min, you're...I-"
Interupted by a kiss of his, embraced by his plump cushions. Almost like silk, so smooth, your heart began to melt all over again. Mark pulls away, his hands release yours; his thumb now grazing your bottom lip.
"It's okay to be shy Y/n. Besides, I know what you like now, so I can help you get un-shy."
You push up at Mark's chest, shocked by the sudden confession. "You pervert", you said flustered. Meanwhile, Mark chuckles finding your little conversation amusing.
"Oh? I wasn't a pervert an hour ago–" Your boyfriend said, kissing your jawline. Flushed face and hiding your face in your hands. "Okay, Okay. I'll stop Y/n." Mark said, plopping to the side of you.
Naturally, you get close to him. "Good kitten...otherwise I'd have to punish you."
"Not Against it", He remarks. Mark's arms weave around you, his hand now softly rubbing your lower back. "Of course you aren't", you say jokingly rolling your eyes.
His fingers gently tracing lines and patterns as he looked down at you. "By the way, Y/n? Are you free tomorrow or..later today?" Mark asks.
You yawn as you answered,"Of course, what did you have in mind?"
Mark chuckles at your little yawn, smiling wryly afterwards. "Eh..well, I'll let you in on the full details tomorrow, okay? Lets get you some sleep beautiful."
"That sounds delightful." You said with a smiled. Mark slings his arm around you, pulling you close. There was no need for covers, seemed like Mark was warmer. Though, you didn't complain, you loved it.
"I love you Minhyung."
Sweet lips place a kiss upon you forehead then your nose, then with his thumb underneath your chin, your lips. A cute, meaningful peck..
"And I Love you Y/n— More than you know."
Written June 5th 2023
Guitar Strings || Mark Lee x Fem Reader ||
//TW : SMUT//
(Credits to the owner)
Fem Dialogues, Mark's Dialogues
You were having a sweet time with your boyfriend Mark, while he skillfully played his guitar, trying to put you to sleep after you finally had a break after working hard for your last semester project. This time you spent with him was going very sweet.. until the time it started to get heated...
You lay on the bed next to Mark, who was playing a guitar and putting you to sleep in the middle of the night. You kept requesting songs and he kept on playing them hoping that you would fall asleep.
He cared for you. All these days you had been working on some work project for your university final semester late at night. Now that your work was done and submitted, you felt a wave of relaxation pass over you. Mark took you on a date today at a fancy restaurant and now you both are here, in the sheets, him playing u songs and trying to get u a beauty sleep which you deserved after so much of hard work.
"Go to sleep already, princess.. You did well in your project and now you deserve your sleep"
"I will sleep, Mark.. Just let me stare at you.. I haven't even admired you nicely due to my work.."
"Baby~ if you want to just admire me.. then how about this.."
Mark picks you up and places you in his lap, just to give you a closer look of what he looked like so you can peacefully admire your handsome and caring boyfriend.
"Is this okay?"
"Yes"
Mark placed a soft and gentle kiss on your lips and continued playing the song.
"Hey Rose, I bought you five roses won't you come to my show~ Show you how to live life yeah you know you fucking gold~ Give you all my time if you wanna take it slow~ Your soul is lovely~"
You smiled as he sang the song. It had a beautiful meaning to you. He used to sing this song back in the days when you guys were best friends in college.
You and Mark were childhood friends and it was like a typical friends to lovers trope for you both. He was the popular student who was in the school band and choir, got amazing grades and also a million proposals. On the other hand, you were the 'nerd'. Not like you were a dumb student. You were just like Mark.. excellent in all subjects and an amazing theatre and acting student. The only difference between you two was that you never got a single proposal. Only once, your crush came to you and asked you out but turned out that he was just joking around and never loved you. You got scared to fall in love after that one incident.
But maybe the universe had some other plans for you. Time passed and you fell for Mark. You fell for him to the extent that you would do anything to spend time with him or even get a glance of his face. On the other hand, Mark had fallen for you a long time ago. He too was scared to ruin the relationship you already had with him. He knew why you were always scared to fall in love with anyone. He knew everything.. everything from your family to your darkest secrets.. the ones which no one knew but him. He didn't want to break the trust you had in him.
The day came and you were going to ask him out. Nervousness spread over your body when you called him to sit next to you as you wanted to talk.
"Hey what happened?~~"
"Uhm.. I wanted to talk to you about something... something serious.."
"Yes yes of course.. tell me what is it?~"
"Mark.. I've held it in for a long time now.. I know you know that I'm scared to fall in love with anyone.. but I guess the world had other plans for me.. I know you don't think of me the same way as I do.. but I've fallen for you Mark.. I've fallen for you--"
Poor Mark was in a state of shock after hearing the words which escaped out from the lips of the person he loved the most. Without wasting any time, he cut her statement by pulling her into a kiss. The first kiss for both of them. Y/n felt butterflies as she felt her lips meet with Mark's soft ones.
"I love you too Hwang Y/n"
A wide smile crept up on Y/n's face as she heard this statement. She got pulled by Mark into a big and comfortable hug. Mark, being so fond of his lover, he placed soft and delicate kisses on her forehead, cheeks, nose, lips and everywhere else on the face. The classmates admired the new couple. Some of them were jealous because now they have no chance with Mark but deep inside they were also happy for the couple.
Thinking about this, Y/n smiled while sitting in the laps of her boyfriend.
"What's with that beautiful smile, Princess?"
Mark asked while playing the guitar, realising that Y/n has still not gone to sleep.
"Nothing.. The song just reminded me of the time I asked you out to be my boyfriend.. Those were some amazing moments from my life."
Mark chuckled at the response and put his guitar aside and placed you delicately on the bed as if you were a fragile article made of glass which would break if not handled carefully. He lays next to you and you feel his not-so-cold hands hugging your thin waist. His hot breath can now be felt on your neck. You turn around to face him, only to be met by his lips on yours. The kiss was soft and pure. It was so innocent. It meant no bad. Until.. the kiss started getting deeper and more heated. His lips captured yours so perfectly as if they were sculpted for each other. Both of your lips moving in rhythm with another.
Mark broke the kiss to catch his breath and gripped tightly on your waist, pulling you closer to his body. You put your hand on his heaving chest, catching your breath. The male starts placing soft but lustful kisses on your milk-like soft skin. Soft moans escape your lips while he creates reddish-purple artworks on your white skin. You were like an empty canvas for him to paint and create whatever he wants on it.
Mark detaches his lips from your skin and admires the marks he left on your skin. He made sure to put his marks where people can see that you were taken. He was possessive over you, but not in a toxic way. He loved you a lot. He never wanted to hurt you. That's maybe one of the reasons he was vanilla mostly but he went rough if u asked him to.
He turns you over and hovers on top of you.
"You want me to put you to sleep like this?~"
"Yes please"
That was it. He had your consent. He starts undressing you. Slowly taking off every piece of clothing which prohibited him from seeing your body. He starts placing delicate kisses on one of your breasts while massaging the other with his hand. He loved your chest.. but what he loved more was the beautiful flower you had hidden below your loin. He moves down placing kisses on your belly, not leaving any inch untouched.
He reached between your inner thighs and started making love marks all over them, slowly reaching near your folds. You could feel his breath on your clitoris. Soft whimpers come out of that mouth because of the stimulation caused. Mark slowly started to kiss your folds and soon licked your clitoris.
He kissed your folds as if they were your lips. When he felt they were wet enough he started to stroke your pussy as if it was his guitar strings. He used his skillful fingers on your folds and clitoris. You could never get used to this. He always played a new rhythm... and that's what made you more sensitive to his touches.
He pumped 2 of his fingers inside you and started to curl them up causing lewd sounds to come out of your lips. He loved them. He loved them so much that they caused him to add in the third finger in your, now clenching, hole.
"You like it, princess?~ You like how I pump my fingers into your needy and wet hole?~"
"Y-yes Mark. I love it"
Mark, smirking, pulls out his fingers as feels that you are going to orgasm resulting in you whining at the feeling of getting edged like this. He takes out a condom from the drawer beside the bed and slips it over his length.
He gets in the position between your legs and looks in your eyes as if asking 'Should I?' and you nod. (Who wouldn't nod if Mark Lee is asking to fuck you.) Mark puts half his length inside. He went in deep. Just the perfect size for your depth. If he would get inside your warm cave fully, he would easily reach your prostate. You could never get used to his size.
After you adjust yourself around his length, he starts moving. Perfectly hitting all the undiscovered spots of your depth.
The room was filled with your moans and Mark's grunts as he thrusts in your hole. You asscheeks were red with the marks and spanks he left on it. It looked red like the watermelons he loved. Thrusting deeper in you, Mark soon started to twitch inside you and you started clenching around him.
"Mark.. im-"
"Cumming? Me too. Just wait for me"
And with that, Mark and you, both, release your load over each other. Mark pulls out and throws the used condom in the dustbin.
"Just lay there baby~ I'll clean you up~"
Too weak to say anything, you nod, getting a smile from him in return.
After cleaning you up, you feel his hands snake around your waist as he snuggles up in your neck.
"Can you sleep now?"
He asked, looking at your tired state.
"Yea"
Mark's smile shows up as he makes you face him and kisses your forehead.
"I love you so m- oh.. you're asleep already"
Mark chuckled after seeing how you fell asleep so fast after the heated session you both had a few minutes ago. He smiled to himself after seeing how innocent you look while sleeping peacefully. Everyone thought you just looked like an angel.. but only Mark knows what's behind that 'innocent face'.
✨SWALLOW YOUR WORDS – l.d.h.✨
© sparklysung – 2021. all rights reserved. no reposts, modifications and/or translations allowed.
pairing – lee donghyuck x female!reader
genre – smut | non-idol!au, enemies to lovers!au
warnings – switch!donghyuck, switch!reader, lap dance, cumming in pants, grinding, dry humping, cum eating, hair pulling (giving and receiving), spanking, mirror sex, protected sex (reader’s on the pill), degradation, dirty talk, bondage (belt), possessiveness (i guess?)
word count – 6.043 words
summary – it only took a couple of words to make the blood boil in your veins and being the competitive individual you are, you had to prove lee donghyuck, your all-time enemy, wrong.
note – not my best, probably could've done better, but oh well. also this was frkng hard to write, damn, and i may have changed things a bit? BUT, i think it's better like this so… hope you enjoy! btw, i got the idea while reading this, so go check it out –it's good–.
taglist – @prvncejxon, @iwishihadabettername
another friday night wasting your time at some random classmate’s party. you were everything but happy to be there. you didn’t even want to go there in the first place, only finding yourself sitting on the kitchen counter, drink in hand and an ugly scowl adorning your face, because of your annoying best friend.
“hey, i get it, you didn’t wanna come here when you could have been peacefully sleeping in the comfort of your room, but come on, at least try to have some fun. you’re already here anyway.” eunbin –aka your annoying best friend– said, pouting her lips in a failed attempt of looking cute.
you kind of felt bad for her, you suppose it wasn’t exactly easy to deal with your lazy ass. but still, she was supposed to love you and appreciate you just the way you were.
and most of the time she did, just not in this specific situation.
“this isn’t fun at all, i just wanna go home. there’s nothing in here for me at all.”
you brought the red plastic cup to your lips, taking a sip of the bitter liquid eunbin had mixed for you. you weren’t lying, there really wasn’t anything that would make you want to stay, only a few friends of yours getting drunk somewhere in the big house you were currently in.
“come on, please, stay for me,” eunbin fake cried, and for a moment you thought she was going to give up and let you go. “in a bit the guys are gonna play something fun! we should join them, please?” as her last resort, she looked at you with puppy eyes. she was playing dirty and she knew it, you both knew you couldn’t resist them.
giving in with an exasperated sigh, you jumped off the counter to get yourself another drink from the bar in the living room. you were minding your own business until you heard him, the last person you wanted to see at the moment.
“so, i’m telling you guys, she was literally begging me to fuck her, she even moaned while sucking me off–,” donghyuck’s obnoxious voice filled your ears, making you roll your eyes. he was surrounded by a couple of other guys you didn’t know so well but were sure you had seen them before around campus hanging out with him.
“shut up already, dongdong, no one wants to hear it.” you interrupted, walking past him and towards the half empty bottle of vodka on the bar counter.
the group of boys stopped abruptly, all of them turning to look at you, ready for the scene that was going to take place in matter of minutes. donghyuck’s attention also turned to you, biting back a triumphant smirk with a raised eyebrow. he could see past you so he didn’t mind the mocking nickname you used; he could tell you were trying to irritate him enough to make him go away. but he wasn’t going anywhere anytime soon. he had been eyeing you all night, trying to find ways to get under your skin to catch your attention. and finally, after staying at a safe distance for a while to not spark suspicions, he got what he wanted.
“why so feisty, babe.” the cocky smirk he gave you just made your blood boil, the growing desire to punch it off his pretty face only getting stronger the more you stared at him.
“don’t you get tired of talking shit all day?” you barked, eyes trained on his body while pouring yourself a good amount of alcohol.
you were certainly going to need a lot of liquid courage to get through the night.
“you boast about girls begging for you but i think you’re just trying to hide the fact that you’re the one who has to beg to get laid.”
“i don’t beg, baby.” you rolled your eyes and muttered a ‘sure’. “also, if you’re jealous of me fucking other girls you just had to say it. i wouldn’t be against giving it to you instead.” the stupid wink he threw at you made your body shake in anger, already fed up with the conversation.
“you wish, asshole.”
“actually, i do.”
donghyuck was so fucking annoying, always teasing you and never leaving you alone. your personalities clashed constantly resulting in fights filled with screams and curses, sometimes to the extent of interrupting the class and getting the two of you kicked out of it. he enjoyed watching you struggle and suffer due to his awful pranks, so you were his favorite target. you couldn’t even have a proper date with anyone because he made sure to mess it up either by scaring the crap out of the guy or sabotaging your plans. he almost completely ruined your love life and cockblocked you forever.
you did not get along and everyone knew it.
although eunbin thought it was pure sexual tension and you just needed to get your frustrations off of you with a good fuck.
it wasn’t though.
or was it?
“let’s go hang out with the guys,” your best friend nudged your arm excitedly and you sighed, not feeling like playing anything with them. every time you decided to give in and take part in ‘something fun’ with the guys, it always ended up with you either in trouble or scarred for life.
you had a bad feeling about this all.
“ugh, fine.” she cheered and pulled you through the crowd of drunk people until you reached the basement.
the sound of laughter and screams drowned the music blasting upstairs, there were empty bottles of alcohol sprawled all over the floor and tables and a circle of people in the middle of the room. both of you joined the group with you sitting between eunbin and mark, a close friend of yours that you sadly shared with donghyuck. while you casually chatted and played around with the boy, happily laughing the night away, you could feel a pair of eyes burn holes into your skull. you didn’t have to look up to know who those eyes belonged to, as said person wasn’t even trying to dissimulate.
and by said person you meant donghyuck.
donghyuck hated the way you leaned on mark’s body, how you let his friend rest his head on top of yours and wrap his arm around your waist.
he was jealous, really jealous of your close friendship with the older boy.
mark and you had been friends for a long time now and you could even consider him your best friend, so you were comfortable around each other. you usually hugged, held hands and cuddled, he was used to you wearing his clothes –half of your closet were stolen hoodies that once belonged to him–, he even had a spare change of clothes in his room just in case you decided to drop by for an improvised sleepover. so it wasn’t surprising when sometimes when the two of you hung out on your own, people –even your friends in common– mistook you as a couple.
and the idea of you two dating made donghyuck feel sick to the stomach.
“we’re playing truth or dare, who wants to start?” seoyeon, one of your friends, spoke while looking around for someone to volunteer.
“i’ll go.” lucas raised his hand and everyone nodded, not minding.
the game went smoothly for a while and eventually, the more alcohol everybody drank, the crazier things got. mark ended up getting dared to lick whipped cream off of yuta’s chest and xiaojun had to cross-dress and dance on a table. everything was fine, you hadn’t been picked by anyone yet so you were pretty much having fun just enjoying the show.
until someone called your name.
“y/n, truth or dare?” jaehyun asked with a smirk.
he had an evil glint on his eyes making you feel suspicious. you knew you couldn’t choose truth or else everyone would make fun of you for being a pussy. and jaehyun just knew you well enough to know you weren’t going to let that happen.
you weren’t one to back down.
still, the way he stared at you made an uneasy feeling settle in your stomach.
what could he possibly have in mind?
“dare.”
seems like your gut feeling was right after all.
“give hyuck a lap dance,” jaehyun said immediately after the words left you mouth, making everyone in the room shake, some in excitement and some –you– in anger. donghyuck wasn’t expecting to take part in the dare, but he really wasn’t complaining either. “thank me later babe,” his shit-eating grin only adding fuel to the fire.
fuck.
just as eunbin, donghyuck could sense the sexual tension. and unlike you, he acknowledged it.
but for him it wasn’t just that.
you two had known each other –or at least acknowledged each other's existence– for a few years now, since high school. he was forced to see you almost every day at school, so, naturally, fondness for you started growing slowly in his chest. but it wasn’t until you both left for college that your ‘enemies’ label was established.
and if someone thought he may possibly like you, they were damn right.
he did.
it all started during freshman year, when he tried to befriend you during one of the classes you shared. you seemed irritated by his advances and wanted him away from you, so after a few attempts of softening your heart, he resolved that the only way to stay close to you was annoying the hell out of you.
childish? yeah. he cared? not really.
“come here, babe.” donghyuck tongued the inside of his cheek, a smirk forming on his lips. as he saw the grim look on your face, he sprawled his legs, patting his toned thigh invitingly, eager to get things started.
the look jaehyun gave you had ‘you’re not backing down, are you?’ written all over.
“shit, i hate jaehyun, why did he have to do me dirty like that?” you mumbled angrily to eunbin and she just laughed, finding the situation way funnier than you.
“maybe tonight won’t be as boring as you thought? maybe you’ll end up getting laid.” she wiggled her eyebrows suggestively and you only scoffed, “shut up, dumbass.”
“why did you have to do me like that, huh?!” you almost screamed at the older, taking a mental note to beat him up later. he just shrugged and threw you a wink, “asshole.”
mark patted your back to help you relax, he could see you weren’t exactly happy about your dare.
“come on, which song would you like, my lady?” lucas asked, scrolling through his spotify for suiting songs.
“or nah!” yangyang answered before you could even open your mouth. just as you were about to ask for a less sexual song, cheering erupted through the room.
everyone was pumped, adrenaline running through their veins and pushing them to do stupid stuff they would probably regret the next day after waking up hungover. and things just took a rather interesting turn, so they obviously were excitedly awaiting the next series of events.
yay, more stupid memories to regret later.
on the other hand, donghyuck was as doomed as you. he knew the song well, he knew the lyrics by heart but what he didn’t know was if he could control himself with you basically dry humping him in front of a bunch of people to the rhythm of it.
he wasn’t sure it was a great idea.
as soon as you got up to complete the dare, you heard cheering and clapping. and you weren’t going to lie, you wanted to throw yourself out of a window.
breathing deeply in an attempt of relaxing to just get it over with, you made your way towards donghyuck until you were standing a few feet in front of him.
as the music started playing, you started moving. running your finger on the surface of his clothed shoulder, you walked slowly around him, like a predator circling its prey. he tried not to follow your movements, already getting anxious by your closeness and nervously waiting for your next move.
i’ma smoke this joint then i’ma break you off.
i’d be lying if i said you ain’t the one.
you pushed his legs open and settled between them. your hands rubbed his thighs teasingly, fingers drawing closer to his crotch but not quite getting there. you took your sweet time feeling him up, softly scratching his strong arms and leaving red trails behind. donghyuck was so into it, enjoying the sight of you kneeling before him so much that his pants were already starting to feel tight.
heard you not the type that you take home to mom.
is we fuckin’ when we leave the club or nah?
i ain’t spendin’ cash for nothin’ i wanna see you take it off.
and oh how he wanted to see you take it off. all night he couldn’t take his eyes off of your figure, you looked really good in the outfit eunbin had chosen for you.
so good it was almost making him drool.
you sat on his lap, hands going to caress his toned chest and stomach. it was well-known that donghyuck exercised frequently, but it still surprised you. he felt so good you had to bite your lip to prevent a sound from coming out.
when you shifted to sit closer to him, his hands flew to your hips and you could tell his intention was to move them lower to grope your ass, but you weren’t having it.
do you like the way i flick my tongue or nah?
you can ride my face until you’re drippin’ cum.
“if you try to touch me again, i’ll tie you up,” you said with a sweet smile plastered on your face, grabbing him by the wrists and harshly dropping them away from you. donghyuck let out a startled gasp at that, obviously not expecting your attitude. with his hands twitching to grasp anything, he went to grip tightly the sides of the chair.
can you lick the tip then throat the dick or nah?
can you let me stretch that pussy out or nah?
your hips ground against his crotch at such a slow pace that donghyuck was having trouble not pushing you down on him faster. he was getting embarrassingly hornier as seconds passed and wanted nothing more than to fuck you right then and there, even with his friends’ eyes on you both.
donghyuck tried so hard to restrain himself from touching you. he wasn’t one to follow orders, but he tried just for you, he really did.
i’m not the type to call you back tomorrow.
but the way you wrappin’ ‘round me is a prob.
and everything was fine until you kissed him. synchronized gasps filled the room, the sudden show of affection confusing everybody. not even your intoxicated self could understand what the hell were you doing nor who you were doing it with. his breath got stuck in his throat, heart thumping against his chest at an alarming rate. his hands almost tried to bring you closer, but he realized what he was doing on time to stop himself.
he finally broke down when your mouth sucked on his tongue, making his hips grind up against yours unconsciously as his hands grabbed you by your waist, pressing your body flush against his.
that was it.
“you asked for it,” your movements came to a stop as you took off your black leather belt, sticking to your threat of tying him up if he didn’t quit it.
pussy so good, i had to save that shit for later.
took her to the kitchen, fucked her right there on the table.
“oh shit,” donghyuck stirred under you trying to get out of the situation.
this couldn’t be happening.
“no, please,” he whimpered as you fastened the belt until it was wrapped tightly around his wrists, locking his arms behind his back. your audience was unable to hold in their surprise, some mouths falling open. he fought against the restraints to no avail, desperate to free himself, “please, let me go,” he cried out quietly, not wanting the other occupants in the room to hear him.
“stop complaining or else i’ll also gag you,” you spat harshly in his ear, done with his attitude, and he swallowed hard. as you nibbled on his lobe, you felt a strong sense of confidence. it made your chest swell in pride to see the usual big mouth jerk with a smug grin constantly attached to his face falling apart under your touch.
seems like he was the one to beg, after all.
you moved your hips to the rhythm of the music, making sure to press harder against the sensitive tip of his cock, which was already leaking precum. although you weren’t an expert, you’d given a fair share of lap dances, so you knew what you were doing.
and donghyuck could certainly tell.
don’t play with a boss, girl take it off.
take it for a real one.
you gon’ get it all.
“whose bitch are you now, huh?” donghyuck couldn’t speak properly, way too hot and bothered for his brain to come up with any smart-ass response.
you tsked disapprovingly at his lack of response.
“when i ask you a question, you answer.” your fingers tangled in his hair and with a harsh tug you forced him to look up. donghyuck was dazed, lips swollen from you biting on them, eyes glassy from arousal, and mind clouded with lust.
“yours.” he whimpered quietly, forgetting momentarily about your audience.
“good boy.”
you loved how easy it was for you to break him and leave him wanting more, to have him so putty in your hands. specially since hearing comments of other female classmates about donghyuck teasing them almost till the brim of tears was part of your day-to-day life. it felt like you were getting revenge for all of them, so you were enjoying it a lot more than anyone could imagine.
your plump lips trailed down the length of his neck, leaving wet kisses along his honey-like skin, and he threw his head back to give you more access. as you licked, sucked and bit the flesh, donghyuck could hear his heartbeat loud over the music. he usually wouldn’t let a girl suck hickeys on his skin, but the idea of you marking him while everyone watched was rather exciting.
he swore the seconds passed slower than usual. you were just halfway through the song but he didn’t know if he could survive any longer.
donghyuck felt light-headed and painfully aroused, and he wasn’t going to last long if you kept kissing him and moving your hips the way you were.
“i’ma go as far as you let me,” your movements became slower to tease him, making the poor boy want to cry in agony. his jeans felt way too tight to be comfortable and he hoped everyone could just leave you two alone to take it off.
“shit, please,” donghyuck’s eyes closed, head falling forward and hanging low as drops of sweat slid down his forehead. the room felt like an oven and he didn’t know if it was a result of the significant amount of people in such a small space, the alcohol, his choice of clothing or your body pressed closely against his.
probably the latter.
girl, is you sucking me or fucking me or nah?
can i bring another bitch? let’s have a threesome.
“keep saying you’re a freak, you gon’ prove it or nah?” you quietly sang along, pulling his face closer by his hair and grinding down on him harder.
donghyuck was going crazy, he had never expected you to be so sexy, to behave so dirtily. but he loved it, and by the prominent tent in his pants, everybody could tell he was in for the ride of his life.
you’s a ride-or-die chick, you with this shit or nah?
say you not a side bitch, you all-in or nah?
you gon’ make them eggs cheesy with them grits or nah?
you brought him in for a hot kiss that left his head spinning.
donghyuck was growing restless as his climax neared, he was so close he could almost taste it. he couldn’t remember when the last time he got so close to cumming only from some teasing was.
everything was happening so quickly he wasn’t able to stop himself before giving in to the pleasure.
“h-holy fuck,” with a shaky moan that you swallowed, donghyuck shot his load, staining the crotch of his dark jeans. you could feel the wetness seeping through the piece of clothing and dampening your bottoms. his hips gave a few more sloppy thrusts, legs shaking weakly and cock twitching from the confines of his jeans, before falling limp on the chair.
or nah.
as the song ended, he came down from his high. you freed him from the iron grip of your belt, the skin on his wrists was red and slightly swollen. you may have tightened it too much in the heat of the moment, but you weren’t apologizing after giving him probably the best orgasm of his life.
the bewildered expression on his face quickly turned grim as it hit him.
he came in his pants like a fucking teenager.
in a room full of people.
in front of his friends, yours and you.
his friends stood there, both confused and surprised to see donghyuck so affected by your touch. nobody had expected things to end the way they did.
“damn, are you okay my man?” johnny asked, laughing at his friend’s flustered state.
“shut up,” donghyuck answered bitterly. he shot up from his seat, grabbing your hand and shoving you inside the nearest bathroom in the house. he didn’t even care to cover the wet spot on his pants, walking with his chin up and a scowl plastered on his face.
and blame it on how riled up you had gotten from the feeling of his hard dick pressing against your needy pussy, but damn, he looked good.
“i wanna go next!” hendery spoke excitedly. you couldn’t tell if he was just messing with you or if he actually wanted you to give him a lap dance too. either way, it made your lips turn upwards in a smug grin.
once you both made it to the bathroom, he locked the door before pushing you against it, back pressed flush into the hard piece of wood. the ambience took a 180 turn, your confidence faltered slightly at the sight of his angry form.
“you think it’s funny, yeah?” he hummed angrily in your ear. “you think i’d let you do whatever you want and embarrass me in front of my friends just because you feel like it without payback?” the look on his eyes getting darker as the words left his mouth.
“if so, oh baby, you were so wrong.”
trying to test him, you decided to answer.
“you’re all bark and no bite, what else am i supposed to think?” you smirked devilishly when you saw him clench his jaw.
“you’re gonna regret being a brat,” his slender fingers wrapped themselves around your waist and with a harsh tug, he pulled you closer to attack your lips, biting and sucking on them, making your legs wobbly. he tasted sweet and bitter at the same time, probably from the liquor he had been drinking all night, and you couldn’t seem to get enough. his lips were soft and plush as they mingled with yours, teeth roughly clashing and tongues fighting for dominance, “am i?”
donghyuck hissed through his teeth as he unbuckled his pants, letting his cum-covered shaft spring free. he was already hard and you unconsciously rubbed your thighs together to ease some of the tension building up between them. his hand shot to your throat, tightening his grip until you couldn’t breathe properly, before forcing you on your knees.
donghyuck tapped his hard and heavy cock on your lips a couple of times before speaking. “open up, slut,” and you did as you were told, parting your lips and poking your tongue out, waiting for him to slide in.
but he didn’t.
he wanted you to lick him clean, he wanted to see you do as he said, follow his orders like a good girl without complaints.
“clean the mess you’ve done. now.”
the harsh tone of his voice sent a wave of arousal straight to your core. your hands immediately shot up to grab a hold of his length, but before you got too close he stopped you. confusion was written all over your face and for a moment you worried he had changed his mind.
“no hands, i want you to work on it only with that dirty mouth of yours.”
with your hands gripping onto his thighs, your tongue swiped from the base to the head of his cock, eagerly licking him clean. once you had swallowed every drop of his cum, your mouth took him whole, hollowing your cheeks, one hand massaging his balls. donghyuck threw his head back as yours bobbed at a rapid pace, the tip of his cock reaching the back of your throat as you swallowed around him.
when he was about to cum, he pulled away from your mouth, making you whine at the loss. wrapping his hand once again around your throat like a beautiful necklace, he forced you up on your feet. he turned you around before pulling you closer by a rough tug. your clothed ass pressed against his dick, a mixture of his arousal and your saliva wetting the cloth. your hips ground back to both tease him, desperate to feel something, anything. his hands went to the front of your jeans, rubbing his fingers over your clothed clit and a whimper fell from your lips.
“more, i need more,” you pleaded, the barrier of clothes making the feeling less pleasurable.
he surprisingly complied without resistance, dipping the digits under the restricting cloth. a deep groan vibrated against the side of your neck when he felt the wetness that had been gathering inside your panties since your dare.
“look at you, so damn wet,” his mouth watered at the feeling of your needy heat. at this point, donghyuck knew everyone had an idea of what you two could possibly be doing, and although he would enjoy returning the favour by eating you out to his heart’s content, there wasn’t enough space nor time to do so comfortably. but he swore he would make it up to you some time.
“for who is it, baby?” the answer was obvious, but still, he wanted to hear it directly from you. he inserted one long finger until it was knuckles deep inside of you and you let out a squeak, head falling back onto his shoulder.
“for you donghyuck, all for you.”
“that’s right, slut, only i can make you that wet, only i can touch you like this. you’re mine, don’t forget that,” he inserted a second finger and pumped them deeply into you.
“yes,” you breathed out softly, too far gone to fight back with a snarky remark.
although his fingers felt good and you could possibly –with a bit of an effort– cum just from them, you still wanted more. you wanted to feel the nice stretch of his cock tearing your walls apart.
“please, donghyuck.”
“what do you want?”
donghyuck knew what you wanted. fuck, he wanted it too, so bad. he had been waiting for an opportunity like this for a long time and now that he could finally have it, he was going to make the best out of it.
“fuck me,” your core ached to be filled so you swallowed your pride and spoke out.
“condom?”
“we don’t need it, i’m on the pill,” you rushed, stomach twisting and turning in excitement, “please, just fuck me.”
donghyuck’s eyes turned darker, lust clouding both of your minds with the only desire to fuck each other stupid. he pulled down your jeans so they were pooling on your ankles and went back to pump his fingers inside you to make sure you were ready to take him. as he entered you, you had to lean on the sink in front of you to hold yourself up or else you would have faceplanted the mirror.
“you feel so good, fuck, so fucking tight,” donghyuck growled when he was balls deep in you.
whimpers fell from your lips from the delicious stretch of his thick cock. after a few seconds of you adjusting to his size, you backed your ass into his hips to let him know you wanted him to move. he gave a couple of thrusts to test the waters before picking up his pace and you gripped the sides of the sink as he pounded into you. his mouth worked on your neck while you brought one of his hands under your shirt to play with your breasts.
“such a pretty sight, don’t you think?” he tugged harshly at your hair to force you to look at your reflection on the mirror, thrusts never faltering.
your makeup was ruined; lipstick smeared messily all over your lips from the hot make-out session, neck full of bruises donghyuck left to claim you, shirt pulled above your breasts displaying your puckered nipples while one of his big hands grabbed your boob as they bounced with every hard snap of his hips.
“you have no idea how many times i had to control myself not to pounce on you,” his eyes never left your quivering reflection, completely in love with the way your frame molded with his, “every single time you couldn’t keep that pretty little mouth of yours closed and all i wanted to do was shut you up with my cock.”
“f-fuck,” his thrusts turned rougher as his free hand wrapped around your neck, tightening his grip and amplifying the mind-blowing sensations he was giving you.
your asscheeks slapped against his hips, which drilled against you at an unhuman pace, hitting the right spots with every snap and making your eyes roll to the back of your head. you couldn’t keep your mouth shut, loud moans threatening to fall from your lips so you slapped your palm over your mouth to muffle your sounds.
“don’t, i want to hear you,” he gave a particularly hard thrust to try and draw a sound out of you, “i want you to be so loud that all of our friends know what we’re doing, i want them to know how good i’m making you feel.”
specially mark.
but he wasn’t going to tell you that.
“h-hyuck,” you couldn’t hold back the broken moan that fell from your lips, pleasure overtaking your body. your hands gave in and you almost fell forward, but donghyuck reacted sooner and pulled you by your hair, holding you up.
“address me properly, brat,” he growled in your ear. you felt a hard slap on your ass, the skin of the abused area stinging from the impact.
“i’m sorry… fuck, donghyuck,” your cries went straight to his dick, urging him to fuck you harder. he kneaded the flesh soothingly before spanking it again and again until you could make out the imprint of his big hand on your asscheek.
“f-faster, please,” you pleaded in a whine and he tsked, shaking his head, “such a greedy little slut.”
“what would everyone think of you if they could see you so eagerly taking my cock, mm?” donghyuck hummed, “begging for me to fuck you until you can’t walk properly?
shocks of pleasure shot through you, his dirty talk helping you reach your release faster than you anticipated. his grip on you was so tight you were sure you were going to be sore the next day. your moans turned pornographic as you neared your release, your walls squeezed around donghyuck to the point he was unable to move, so he started drawing circles over your sensitive clit to help you get off.
“let go, baby.”
and soon, his touch threw you over the edge, causing your body to shake and a broken moan to fall from your lips, legs weak as your whole weight only relied on your arms for support. he followed shortly after, grunting as he filled you up with his warm and sticky essence.
as he pulled out, a mixture of your slick juices and his seed leaked from your abused hole, dripping down your inner thighs. his fingers slid over to gather the drops of cum and opposite to your assumption, he didn’t push it back inside of you but brought the digits to your face, waiting for you to open your mouth.
“suck.”
and you did, eyes locked with his through the mirror as your tongue swirled around his fingers to lick them clean.
“fuck,” donghyuck sighed, “i didn’t know you were so dirty, sweetheart.”
and the teasing comes back.
“do you want me to remind you how i made you cum in your pants back there in a room full of people?” you rolled your eyes in disbelief and he just let out a breathy laugh.
“whatever. either way, even if they didn’t have the pleasure of fucking you or at least seeing you get fucked, they surely could hear you from how loud you were screaming my name.”
“good thing mark now knows who you belong to,” the words slipped out of his mouth before he could think and both of you shared a look of pure shock.
“did you just mention mark?”
“…no?”
“you did! what the fuck? were you jealous of mark?” you asked, eyes wide as you remembered the disgusted look on his face when you and mark got too touchy with each other during the game.
“i am jealous of mark.”
“what? why?”
“oh my god, you’re so dense.”
“shut up, i’m not.”
“yes, you are. i like you dumbass, that’s fucking why. why wouldn’t i be jealous if you two act like you’re dating but always deny it when questioned? i can give you my hoodies, i can cuddle you and hold your hand, i can spoil you with cute stuff. i can be your boyfriend, it doesn’t have to be him.”
everything was so weird.
you were supposed to be enemies for fucks sake.
but he looked cute with pouty lips.
“well, you sure have got a damn weird way of demonstrating it.”
“shut up, okay?” donghyuck snapped, done with trying to get you to shut the fuck up. “i just didn’t know how to approach you or talk to you at all, alright?” he sighed, a scowl forming on his face. “you always seem to be angry when i’m around.” the change in his voice shocked you, it was much softer now, as if he was afraid of you hearing it.
“hey, don’t beat yourself for it, alright?” you sighed, feeling bad for being so mean to him for no reason. because you really didn’t have a reason. whenever you weren’t at each other’s throats and you got time to observe him from afar, you saw how caring he was with his friends, even if most of the time he annoyed the crap out of them.
donghyuck actually seemed like a good guy… if you ignored his teasing.
maybe you didn’t hate him as much as you thought.
“so, would you be my-,”
suddenly, the sound of banging on the door resonated through the room.
“are you done already? i need to pee.”
you quickly fixed your clothes, embarrassed by the presence of someone outside the door waiting for you and donghyuck to get out and momentarily forgetting about the boy’s proposal. just as you were about to open the door and get yourself the fuck out of the situation, his arms wrapped around your waist to pull you closer and whisper to your ear in a way you could feel your panties get damp once again.
“we’re not done yet, princess.”
–lia:)
✨FIFTY SHADES OF PAINT – h.r.j.✨
© sparklysung – 2021. all rights reserved. no reposts, modifications and/or translations allowed.
pairing – huang renjun x female!reader
genre – smut, fluffish, angsty, a bit of crack | non-idol!au, best friends!au
warnings – artist!renjun, tiktoker!reader, unprotected sex, grinding, mild spanking, marking, oral (f. receiving), fingering, temperature play (kinda? cold paint so ig), nipple piercings, nipple play, one-sided pining
word count – 17.339 words (oOP i’m so sorry)
summary – teaming up for an artsy tiktok trend with your best friend should be a fun and wholesome experience. but when it quickly turns into paint wars, you and renjun find yourselves involved in a rather messy situation, especially if your innocent video turns out going viral for all the wrong reasons.
note – so, ig i’m back. and with an actually really unnecessarily long and dramatic fic, irdk how i managed to write so much lmao. sorry for taking so long to come up with a new fic but i’m struggling –aside from writer’s block– and i haven’t been able to spend that much time actually writing. also, i’m so late, this isn’t even trendy anymore, but who cares right? this probably has a lot of mistakes so i apologize in advance. a big thanks to one of my friends, @fanficbitchwhowriteskpop, who helped me A LOT while writing this, both with the ideas and the editing (of the gif and the fic). iLY SIS♥️ anyway, i really hope you guys enjoy it and both the long wait and long length are worth it:’) feedback is greatly appreciated!
“so let me get this clear. you want me to paint your ass and legs to leave them imprinted on a canvas?” renjun brought the hand that was holding his brush down, turning to look at you, disturbed. “a new, perfectly clean canvas?”
“gosh, are you even paying attention to what i’m saying?” you sighed, ready to throw hands at the boy in front of you. “i clearly remember saying asscheeks, legs and foot.”
“of course, how could i forget your foot? i’m sorry, my bad,” rolling his eyes, your best friend turned his attention back to finishing up the base of his next painting. “is that it or am i forgetting some other relevant piece of information?”
“nope, that’s basically it.”
“why would you even want to do that? it’s so much work for literally nothing,” he frowned, not getting the point of it all, “and also a waste of so much expensive, good-quality paint.”
how could people actually think this was a good idea? for fuck’s sake, we’re in the middle of a pandemic and they still go out of their way to throw money away. just like that. it really didn’t make a single bit of sense in his head.
“i already told you, it’s for a tiktok trend: the body art challenge.”
of course such a stupid idea had to come from tiktok, he thought sourly.
don’t get him wrong, though. on a normal day, renjun would be the first to slip on a tight cheerleader uniform and shake his pom poms for you while screaming at the top of his lungs the cringiest chant he could come up with on the spot. he was basically your number one fan, the most loyal friend you could have gotten yourself. and that was one of the reasons why the irritated boy in front of you was your best friend.
renjun still remembered that one time you decided you wanted to try skating for the first time.
it had all started on a summer day, the sun shined brightly in the clear blue sky when your group of friends decided to get together at the nearby skate park and enjoy the beautiful day together. per usual, renjun and you walked together, chatting cheerfully about your plans for the day, excitement running through your veins as you sped up your pace to reach the park quicker. your attention was set on renjun the whole way there, smiling happily at him as you bobbed your head at his words, until you reached your destination.
your best friend watched as your eyes sparkled at the sight of johnny and yangyang doing tricks with their new skateboards, fascination making your jaw hang open.
renjun didn’t need to take another look at your face to know this wasn’t a good idea. actually, he was certain it wasn’t going to end well for you; skating was a risky activity and you could end up hurt if you weren’t careful. but since you seemed so excited to learn, he didn’t have the heart to convince you not to. so, instead of listening to what his head was trying to tell him, he followed his heart and encouraged you to give the sport a shot.
later that day, renjun took you to the mall to buy your first skateboard, promising to come up with an original design to personalize it so it wasn’t plain and boring. and since a promise made is a debt unpaid, he spent the next few days locked inside the art studio one of his older friends, moon taeil, owned. the boy didn’t come out of there until he had forgotten what human interaction looked like and a worthy sketch was messily drawn on a stray sheet of paper he found lying around.
a few days later, the back of your new skateboard had pretty sunflowers painted all over the wood, delicate strokes of the brush bringing the flowers to life. although you never got to know the reason why he settled on that specific design, you were more than happy with the result. and it may or may not have had something to do with the shades of yellow, the meaning behind his last name and his secret hopes of said color reminding you of him. but renjun would never say that outloud.
unsurprisingly, you ended up with a broken arm and a couple of scars adorning your legs. quite honestly, it was a small price to pay as nothing could be compared to the wound the whole situation left in your self-esteem.
that was solid evidence that supporting even your stupidest ideas wasn’t something renjun was unused to. the difference between your usual nonsensical ideas and this body art thing you wanted his help with was, precisely, the 'art' part of it. it was the first time renjun felt you were truly willing to give art another try after years of convincing yourself it wasn’t your thing, that not everyone had the same creative vision nor passion as your talented best friend.
but the sole thought of having to waste such a considerable amount of paint –because painting half of your body would most definitely require at least a couple of tubes of expensive paint he had just bought not even a week ago– on such a meaningless idea was making renjun cringe.
he refused to believe people actually tried this, even less enjoyed the process.
“why do people do this anyway?”
“to give it to their partners as a gift,” you offered with a sheepish smile. “don’t say it! i know i don’t have one, okay?” you whined, cute pout on your lips, as the boy opened his mouth to state facts only, but you interrupted before he could utter a word. “i just thought it’d be fun, y’know?”
renjun quirked a well-defined brow at that, arms folded as he stared at you with an unamused look on his face. the staring contest your best friend and you were taking part in only lasted a brief moment, but it actually felt like a couple of years had gone by. breaking eye contact, he shook his head disapprovingly before taking the freshly painted canvas from the wooden easel and placing it on the table to let it dry.
“and what do you plan on doing with the big ass painting of your butt?” he questioned, carefully examining your face as he walked closer to your standing figure, looking for a reaction that could give away your true intentions. “gift it to jaehyun?”
the name of your –ex, renjun reminded himself– fuck buddy ended up sounding slightly more spiteful than he intended, but truth is, your best friend didn’t like him one bit. and the fact that despite officially dropping said label months ago you still met jaehyun from time to time to fulfill your sexual needs always managed to ruin the younger boy’s day.
naturally, being the naive person you were, you never really understood why renjun disliked the man so much. but even if your best friend's eyesight wasn’t the best –and he should probably get glasses at some point in time–, he still had it pretty clear.
jaehyun was considerably taller than renjun; he had the perfect height for you to bury your face on his chest with his strong arms around you. oh right, the man was also way stronger than tiny, lanky huang renjun; while your best friend spent hours working inside tail’s art studio, jaehyun spent the same amount of time, if not more, training at the gym. aside from that, jaehyun had undeniable good looks; silky hair, peach-colored lips, charming dimples, flawless skin, enchanting vampire-like canines and a lovely smile.
and as if that wasn’t enough, jaehyun was just the type of guy you offered your heart to. you liked attractive men who promised you the moon and the stars just to take them all away when you were only an inch away from their reach.
throughout your weird relationship with jung jaehyun, renjun was able to pick up on a lot of little details you were unaware of, and most of them raised huge red flags inside the boy’s head.
to start off, the guy was supposed to be your friend, so the minimum renjun expected from him was to actually care about you. but the asshole didn’t and wasn’t afraid of showing it. your best friend couldn’t believe how you didn’t notice the way jaehyun would only check on you whenever he wanted his dick wet. he would constantly erase himself from the face of earth just to pop up out of nowhere and pretend he was never gone. his absence was pretty evident to anyone with two perfectly working eyes.
overall, jung jaehyun wasn’t a nice guy and was actually pretty far from being one.
for these and many other reasons, it made renjun’s blood boil to see you run back into his arms every single time with a sweet smile on your lips and your heart in hand.
thinking about all of that was making a wave of anger wash over renjun’s body for no reason… well, he did have reasons.
you were his best friend, his favorite person in the whole world and beyond –because of course, there’s life out there even if we can’t see it yet–, so it was only natural to feel protective over you. after all, he only wanted the best for you. he did know his best friend title gave him zero rights to tell you what –or more like who– you could and couldn’t do, but it still didn’t stop the boy from feeling irked.
why couldn’t you see jaehyun wasn’t good for you?
sometimes renjun wished you could see things from his point of view. he wished you could realize jaehyun was just using you for his own personal gain and spare yourself from heartbreak. you got easily attached to anyone who did as much as offer you a small smile in the middle of the street, and renjun had seen way too many times your heart getting broken by people who didn’t even deserve to have it in the first place. and it pained him every single time it happened, probably more than it should.
“w-what?” you blinked in confusion, face burning, “no? why would i?”
“i don’t know, why would you?” he spat defiantly, biting so hard on the inside of his cheek the skin tore under the pressure.
renjun didn’t want… no, scratch that. he wasn’t going to help if it meant that fucker was going to have a constant reminder of what your ass looked like.
no way in fucking hell.
“i just,” you sighed, “i just wanted to try it out. i don’t know what i’ll do with it yet, but i’ll figure it out later, okay? i promise,” you tried to convince him, a pleading look on your face.
in all honesty, you just wanted to do something that could potentially make renjun happy.
sometimes you couldn’t help but feel like you weren’t trying hard enough to enjoy his hobbies or at the very least share them with him; like you weren’t showing enough interest in what he was passionate about. and it hurt you, it truly did. it hurt you to see him put up with the stupidest shit just to make you happy, and the fact that renjun might feel like you couldn’t even do the same for him made you feel even worse.
you were tired of feeling like a bad best friend.
so when the tiktok of a random girl trying the body art challenge made its way into your ‘for you page’, you thought it somehow was a sign sent from above.
it was the perfect excuse to start engaging in activities renjun loved, in this case art, without having to admit to his face the reason behind your sudden interest in accompanying him to the art studio for the first time in a while. because that would be truly embarrassing.
an image of renjun staring blankly at you as he wondered with disappointment how could you be so dumb made your stomach churn uncomfortably.
an image of renjun staring blankly at you as he wondered with disappointment how could you be so dumb made your stomach churn uncomfortably.
“this is straight up stupid,” renjun snarled, rolling his eyes and shaking his head.
as soon as the words left his mouth, he realized he shouldn’t have said them and immediately regretted being so rude to you. the disappointment flashing on your eyes as you once again tried to reason with him made his heart clench painfully. a tired sigh left your lips, mouth curving downwards as you stared at the ground, hopelessness making your chest feel heavy.
why was he being so difficult?
all the determination you had mustered before walking up to renjun’s door was beginning to tremble at the boy’s resistance and you wondered if maybe you should have just tried something else instead.
no.
you couldn’t give up that easily. you hadn’t walked all the way to the studio for nothing. you had one purpose and you weren’t backing down until you could check off ‘get your head out of your ass and be a better sister from another mister’ from your bucket list.
you had to show renjun you truly cared about your friendship, that you wanted to be a reason for him to look forward to everyday. and most importantly, you wanted your best friend to remember you fondly whenever he did the things that made a smile etch on his face and his ears warm with excitement.
you had been so excited the night before as you watched the girl from the tiktok show the end results, you needed to bring back that same lively spirit and convince renjun to give into you. so, repeating those last few words in your head, you managed to push your frustration as far back into your mind as you could.
so, you decided to try again, this time approaching the situation with another tactic you were sure would work.
one thing you had slowly come to know over the years as your friendship with renjun grew stronger was that he liked coming off as tough to people so nobody would pick on his short height. but you knew better than that.
huang renjun was a complete softy on the inside.
and you could definitely use that to your advantage.
with a feigned gloomy look on your face and crocodile tears welling on the edges of your eyes, you clinged onto him, hugging his waist as tightly as you could while letting out tiny sniffles to soften his heart.
“but injunnie, it’s art! i thought you’d get it… you’re the artistic one, remember?”
a hushed ‘fuck’ against the top of your head almost made your whole facade break down into pieces, so you buried your face into the crook of his neck to stifle the laughs that were starting to bubble on your chest. his body felt all warm and cozy against yours, and you couldn’t stop yourself from humming in contentment.
you genuinely cherished moments like this one, where you found yourself wrapped in renjun’s body warmth, his arms around you as his head rested on top of yours. it felt comforting, like you were in your safespace and no one nor anything could ever hurt you while you were in the boy’s embrace.
at least one of you felt comforted.
meanwhile, being so close to you as he held you in his arms always managed to mess with his feelings. your proximity made him sick to the stomach… although that could also be the chipotle bowl he had for lunch, those beans always upset his tummy…
but it wasn't only his stomach that reacted weirdly, his heart did too. it was like the organ had been running a marathon and was crossing the finish line, but had accidentally tripped over its feet and ended up landing face first into the ground.
“y’know?” you mumbled, lifting your head to look at his face, and renjun hummed, turning his attention back to you… as if it hadn’t always been on you. “you smell like home.”
renjun felt his whole face heat up, the warmth making the tip of his ears turn a cute shade of red before spreading down his neck and chest. your words seemed to have also made him forget how to breathe properly because his breath suddenly became uneven.
your best friend was about to have a heart attack and you were still completely oblivious.
“were you sniffing me? what the fuck, y/n?” he pulled away with a gasp, shaking his head in disbelief.
“so what?” you shrugged, arms following his body to pull him back into you as he took a few steps back. “well, maybe. but that’s not even important. the real question here is where did you get that perfume? i wanna buy one so i can spray it over the shirt i stole from you to sleep comfy womfy once again.”
“stop it, you’re embarrassing me,” renjun whined as he swatted your hands away whenever they came too close to his body, trying to keep a space between you two.
“how can i embarrass you if there’s literally no one but us?” it was now your turn to roll your eyes. “come on,” you drew out the ‘on’ with a pout before continuing, “i just want some love.”
you don’t know what you want, renjun thought, but kept his mouth shut.
your best friend grumbled when you finally managed to engulf him in another choking-tight hug, giving up on trying to push you away. when you snuggled closer, the corners of his mouth slowly turned up in a small smile and he eventually relaxed against you, letting his arms snake around you.
he was truly a softy. but only for you.
there, as you laid your head on his shoulder, renjun thought you didn’t need to smell like home to make him feel at home. because even if you smelled like a coffee shop with your coffee and vanilla perfume, you still reminded him of you two sitting on your unmade bed with a fluffy blanket over your legs on a rainy day, a nice movie playing on the background as a cup of ramen warmed your cold noses and you talked about everything and anything.
you were home. the only home renjun wanted to come back to every day.
your tactic had turned out to be more effective than you had initially anticipated, since not only renjun but you too completely forgot everything about the petty argument over stupid ideas, tiktok and jung jaehyun.
finally, you could breathe in peace without fearing suffocation.
as a comfortable silence fell over your mingled form, you pondered if you should try your luck and bring up the question once again. this time it seemed like renjun wasn’t going to react as harshly since you had already asked before, so it wasn’t news. and well, now you were going to really think about the way to approach the situation before opening your big mouth to not drop bombshells and catch him off guard.
“so…” you started, voice mindfully quiet, careful not to poke at the sleeping tiger between your arms. “can you, mayhaps, help me out… with the painting process?”
patiently, you waited for your best friend’s reaction before continuing. closing your eyes and focusing all your attention on the boy’s breathing, you tried to decipher his emotions. his chest heaved with every inhale and exhale, but it never changed its rate. it always stayed steady, coming in through his nose before slipping past his parted lips and tickling your forehead.
“i know you think it’s stupid… but i thought it’d be really fun if we tried it together… like, y’know, bonding time?” you continued almost in a whisper as your arms tightened their grip around his waist.
his left arm dropped from around you and it almost made you think he was going to push you away for the tenth time up until that moment, but he didn’t. instead, renjun used his slender fingers to softly comb your hair out of your face as a deep sigh left his chest. your best friend let his fingers mindlessly toy with the strands of hair before dropping to the squishy flesh of your cheeks, drawing circles with his thumb as he thought of your words.
the words ‘bonding time' did sound appealing, and the boy almost found himself agreeing to help just so he could have a justification to be unnecessarily close to you. if you were the one asking, who was he to deny you?
a coward. that’s what renjun was. and everyone else could tell but you.
renjun was terrified of his feelings for you. he didn't know exactly how to describe them and less so how to classify them, but he was hundred percent sure best friends weren’t supposed to feel about the other the way he did towards you.
the boy didn’t like the way his hands turned clammy whenever you held them, or the way an overwhelming sense of happiness spread across his body at the sight of you and your pretty smile. he was terrified of the funny feelings in his stomach at the sound of your laughter and the warmth of your hand.
renjun was so scared of what he was feeling that he had stayed up all night more times than he could remember trying to forget the smell of your coconut shampoo and your favorite flavor of gummy bears that you only shared with him.
so rather than dealing with it like the grown man he was, he chose to be a coward and pretend those feelings weren’t there, hoping they would go away as abruptly as they had appeared.
clearing his throat as if it would help clear his mind, he poked your cheek before speaking.
“so you’re showing off your flat ass on tiktok for what, clout?” renjun questioned, brows arched in incredulity, “and you’re not even getting paid for all the hustle and bustle? i thought i raised you better than that!”
a breath you didn’t know were holding made its way past your lips and you scoffed loudly, intentionally stepping your foot over his to reach his height.
“first of all, fine. you can say my ass is flat all you want, but that doesn’t change the fact that i’ve caught you countless times staring at it,” you retorted as you pointed an accusatory finger at him, a smug smirk plastered across your face. “and second of all, i will get paid for it.”
“whatever,” he mumbled, feeling his cheeks burn in embarrassment. “either way, we both know it won’t even be enough money to make up for all the paint wasted.”
“i’ll think of something. stop being salty about it, dude.”
renjun bickered quietly, pressing his red cheek against your forehead lovingly.
it was proving so difficult not to give into you. and he was also running out of excuses.
“can’t you ask any of your girl friends?”
the idea of laying hands on those delicate patches of skin you wanted him to cover in paint, so close to forbidden areas, made his body tingle.
as mark twain once said, there is a charm about the forbidden that makes it unspeakably desirable.
and so it was getting exponentially harder for renjun not to crave what he knew was out of his reach.
you.
everytime you would turn around or bend down to pick up whatever item you had accidentally dropped, his eyes found their way to your ass. that plump, soft-looking ass of yours. that same ass that had given him some of the most awkward boners during his high school years.
sometimes he wondered if you did it on purpose, if you could tell your effect on him no matter how much he tried not to show the crimson hue covering his cheeks or his fumbling fingers.
“you’re not giving up just yet, are you?” renjun felt your head shake against his body as you were now the one trying to push him away.
“you haven’t given up on the tiktok thing either, so you can’t really blame me for trying,” he shrugged, not letting you go. he didn’t want to break the hug just yet, enjoying the feeling of you in his arms.
how he wished you could stay like this forever.
“anyway, i did. and they’re all busy,” you pouted, eyebrows scrunched in discontent. “hayoon has a date tonight with that guy from her philosophy class, jiah and miyoung are going to a party to find someone to take home tonight and iseul has plans with her new boyfriend. they forgot ‘sisters before misters’ real quick,” you sighed, “and besides, i don’t have any more friends.”
lie.
both of you knew that was totally not true. you had plenty of friends, most of them as batshit crazy as you. therefore you had plenty of options to choose from.
so, if you had so many friends, why weren’t you asking them instead?
as if reading his mind, you narrowed your eyes, furiously shaking your head to show your complete and utter disagreement.
“hell nah, renjun, you know i can’t just ask them!”
by them, you meant your other friends. your other guy friends to be more precise.
while you two had different groups of friends in the beginning, you had managed to slowly but surely bring them together into a single, giant one of more than twenty people.
it wasn’t until you realized you had been unknowingly sharing for months two of your closest friends, donghyuck and jaemin, that renjun and you decided to actively try to merge both of the social circles together. and, before you knew it, one casual hangout at the local karaoke turned into sleepovers at chenle’s mansion and a strong friendship between the two groups.
to this day, you wondered how you hadn’t noticed renjun visiting jaemin's flat every other day or playing video games with donghyuck until ungodly hours before bumping into the three boys at an arcade you usually visited with kunhang, jisung, jungwoo, mark and lucas.
it really is a small world.
regardless of how you had met them, it was only natural you wouldn’t feel comfortable being exposed to people who weren't your girl friends. or him, for that matter. renjun himself felt pretty uncomfortable taking his shirt off in front of someone else, so he could only imagine how you would feel if you had to take your pants off under the stare of one of the guys.
either way, renjun didn’t want you to ask them either.
“alright, i guess i’ll help then” renjun agreed hesitantly and you gave his butt a few slaps to replicate clapping noises, satisfied.
his mouth fell open with shock as he finally managed to push you away. “okay, stop that. who gave you permission to touch me?”
“can i touch you?”
“n-no!” he shrieked, his high-pitched tone making you laugh.
“why not?!” you protested with a groan, “you let jaemin spank your bum bum all the time but then i can’t do the same?”
your best friend cringed at the mention of the boy’s name. you had a point though, it was true that –most of the time– jaemin had the green light to touch him as he pleased. at this point in the friendship, renjun didn’t really mind, he had come to terms with the fact that that was just how jaemin was.
the taller boy was an affectionate person by nature. skinship was his thing and it only felt natural for him to express affection and appreciation through big bear hugs, pats on the head or back, hand holding and sometimes even kisses on the cheek. and truthfully, renjun was used to it, even if sometimes he pretended to be annoyed by it. he understood people had different love languages and that was just jaemin’s.
and so was yours.
but with you it was different. a completely different story.
jaemin wasn’t you. and you weren’t jaemin.
“that’s different. and never say ‘bum bum’ in front of me ever again.”
“i don’t get how so, but i guess i’ll have to try again,” you sighed tiredly as if you were starting to lose your patience. “can i get your blessing to smack your fat ass as well, kind sir?”
for a millisecond, renjun wondered if you were into spanking. although you were pretty open regarding your sexual life, you had never talked to him about your kinks or your turn ons. and your best friend couldn’t deny the curiosity he felt whenever said topic was brought up on your group chat.
it was only natural to think jaehyun's kinks would rub off on you after so much time being each other's go-to booty call. after all, he did seem like the type of guy that would enjoy bending you over his lap with your skirt scrunched up above your waist and spanking your ass until your buttcheeks turned a pretty shade of red.
his lips pursed realizing jung jaehyun, once again, managed to slip into his head.
“fuck you.”
the words stumbled out of his mouth before realizing he had just given you thumbs up to annoy him further.
“whenever you’re ready, baby boy,” you winked jokingly, twirling a strand of hair in your index finger in a flirtatious manner and blowing exaggerated smooches.
the boy gulped nervously, the reddish hue returning to his cheeks as his body heated up at the suggestive pet name.
“i’m already regretting agreeing to be your friend.”
“you love me, tho.”
did he?
renjun would do anything for you. like climbing up a 23 feet tree to untangle your handmade kite to bring it back to you safe and sound. or helping you bake five hundred cookies until 4 am for a charity event at the local retirement home because you didn’t want to give the old people living there cold cookies. or sneaking out of his room on a school night during your senior year of high school to buy his monthly allowance worth of snacks for a spontaneous sleepover at yours after getting your heart broken for the first time.
no matter the time or day, he would always be there for you whenever you needed him.
so, to answer the question: yes, renjun loved you without a doubt. and in more ways than one.
but it was only that, fraternal and uniquely platonic love.
do not confuse love with love love, though. it’s not the same.
after all, best friends are supposed to love each other, right?
“what size of canvas do you need?”
his weak attempt to change the direction of the conversation was enough to distract you from his lack of response. it also bought him some time for his heart to get back to its normal rate.
“uhm,” you thought for a couple of seconds, pondering over the question, “i don’t know? i guess one big enough to fit all of my lower body.”
“you can choose the colors you wanna use while i look for one, then.”
renjun sighed anxiously as he entered the storage room filled with newly bought canvases and other art supplies to look for the right materials for your tiktok. of all the times he had been there, this was the first time he regretted ever stepping a foot on it. he felt somewhat trapped, like a wild animal locked in a cage, desperate to break free and run away. but ditching you was not an option, renjun decided as his eyes searched around the place for a window he could reach to no avail.
discarding that idea, he browsed the room. he tried to relax, breathing deeply to calm his nerves as he grabbed paint brushes, different colors of paint just in case you needed more and the right sized canvas.
you sat on the stool closest to renjun’s drying canvas, waiting patiently for your best friend to come back, with two tubes of paint by your side: a brand new tube of white paint and the black one he used previously. he didn’t dare comment on your weird choice of color as he walked out of the small room, settling with just knowing enough to help himself out of the situation.
“here, i think this should fit,” renjun swallowed his nerves and approached you, canvas in hand.
you looked up from your phone as you heard his voice, nodding before taking the canvas out of his grip to inspect it, making sure it was big enough to fit you. of course you wouldn’t want to ruin the art studio’s materials for nothing… it was totally not because taeil would beat your ass if he found out you messed up his precious art supplies. and you were sure you couldn’t count on renjun to cover for you. he would most likely hand you over to your death himself.
humming in approval, you propped it on the easel renjun had used to paint his own canvas, preparing the area for the mess you were about to make.
pressing the red cross button on the bottom of the tiktok app, you began filming the first clip of your video, introducing the trend to your future viewers and showing the materials you were going to need to recreate the viral video you had stumbled across earlier that day.
with his back leaning against the opposite wall, renjun admired you from his place, fingers playing with the hem of his jacket, and he almost instantly forgot why he was so nervous in the first place.
renjun wasn’t able to stop the warm feeling from spreading across his chest at your gleaming face, and he tried to ingrain the image into his brain to recreate it on his sketchbook once he got home. he observed your little mannerisms that he always thought were cute; how you nibbled your lip in concentration, how you tilted your head to the side and slightly closed your left eye more than the other as you tried to decipher how to open the cap of the paint tube in your hand.
a faint chuckle slipped past his lips as he let you struggle just a bit more.
once he had decided you had had enough, he pushed himself off of the wall, eyes always rooted to you as he took a seat on the stool you had previously occupied.
“lonjin, i need some assistance here,” you glanced back with a frustrated expression on your face as you heard his footsteps, tightly gripping the tube of white paint in your hand.
“seriously? now you can’t even open a cap?” your best friend teased, resting his chin on his hand. “how old are you? five?”
“okay, you just literally attacked me for no reason. no need to be so mean, you asshole,” you grunted. “remember you used to believe cold brew was actually called gold brew? ridiculous right?”
when renjun’s expression fell from his face and he let out a huff, annoyed that you were bringing up such an embarrassing memory, you knew you had won.
“yeah, that’s what i thought. now come here and open this thing for me.”
“saying ‘please’ from time to time isn’t gonna kill you. you should try it more often,” renjun mumbled, taking the aluminum container from you.
“just hurry up,” you hushed him, wanting him to open the stubborn tube of paint already.
in the blink of an eye, renjun had managed to achieve what you had spent at least ten minutes trying without any success. your mouth fell open as you stared at the white substance peeking out from the orifice of the now open tube.
“you’re welcome.”
complaining under your breath, you walked back to the wooden easel with the tube in hand. you squeezed some paint into the canvas and used a brush you found lying somewhere around the place to spread the substance.
stroke by stroke, the light beige color of the fabric disappeared under a layer of white, leaving behind a clean background to work with. you were surprised by how easily the brush slid from left to right with each wide flick of your wrist, and you found yourself feeling an inexplicable peace of mind the more you got into it. as you reached for more paint, you finally got to understand why renjun enjoyed art so much.
painting was extremely therapeutic. and also such a great hobby, if you were being honest.
you sighed in delight, not noticing the dumb smile and heart eyes adorning your best friend’s face. renjun could watch you paint all day long and not even one little complaint would fly out of his mouth. he wouldn’t mind either the pain on his backside from sitting still for so many hours if it meant he would get to see his favorite person and his favorite pastime in the same picture.
taking out his phone carefully, he sneakily took a photo of your concentrated state and it took all of his self control not to renew the wallpaper right then and there.
“i think i’m done with the paint.”
renjun nearly fell off his seat, startled, as your voice cut the peaceful silence that had engulfed the room. he wasn’t sure how much time had passed since he was left alone with his thoughts, but he guessed it must have been a while since you seemed to be done already.
the long forgotten anxiety from before made such an abrupt return that realization of the meaning behind your words hit renjun like a bucket of cold water. as he watched you prepare your canvas, he had completely disregarded the whole point of it all.
his fingers fidgeted nervously as you stared at him, waiting for the boy to tell you what to do next.
“we can use a blow dryer to help the paint dry faster,” renjun explained, foot anxiously tapping against the wooden floor. “or do you wanna wait? it may take a while though.”
“i don’t think i wanna wait that long. where do you keep the blow dryer you were talking about?”
“in the blue plastic bin at the bottom left corner,” he jerked his chin to indicate the white storage shelf on your right. “there are two actually. bring them both so i can help too.”
as you looked through the contents of the box, renjun laid old newspapers on the floor to prevent any possible stains before carefully picking up your canvas and placing it in the middle of the covered area.
you and your best friend spent the next thirty minutes sitting on the floor, using the hot air from your respective hairdryer to dry the freshly painted canvas while ‘into you’ by ariana grande played at full blast in the background. the mixed noises muffled the sound of your voices that softly followed along with the song, heads bobbing and fingers tapping to the rhythm of the music.
his nerves eased a bit as he focused on the singer’s voice instead of the thoughts intruding into his head.
once the paint was completely dry, you put away the blow dryers and left the used brush on a glass of clean water to get the paint off of it.
well shit.
it was time for the most awkward part of the whole challenge: the body painting.
“let’s get this over with quickly, shall we?” renjun let out a defeated sigh, a hand coming to ruffle his hair. “turn around.”
with an excited chirp, you obeyed, turning to face the other way before tugging down your leggings and carelessly kicking them away from you along with your shoes to avoid getting them stained with paint.
renjun sucked in a breath at the sight in front of him, gulping hard as his cheeks flushed a bright pink color. your plush ass, on full display, looked as soft as ever, and he had to restrain himself from squeezing a cheek in his hand. the pretty black thong barely covering your sensitive parts from his prying eyes was not helping his situation either, but only making him dizzy.
stop, that’s your best friend for goodness sake, renjun tried to remind himself.
you were his annoying, loudmouth best friend. the same person he had seen bawl their eyes out to coco, only having watched the last ten minutes of the movie; the same person he had seen blackout drunk, sprawled all over the floor as they chatted with a plant; the same person he had to take care of after eating spoiled food for a stupid dare in high school.
shit, this was so wrong.
of all people, renjun was the one supposed to see you for more than just an attractive individual, to turn blind eye to your obvious pretty face and sweet personality and pretend it didn’t make his breath falter and his heart quicken.
“dude, what are you waiting for? the room is cold as fuck and i’m literally freezing to death,” you whined, furrowing your eyebrows. your legs were starting to feel numb and you were already ready to get back into your pants.
renjun reached for the black paint and a thick paintbrush before stumbling towards you. opening the cap, he kneeled behind you and squeezed three pumps of paint onto your upper thighs. he gulped, hand shaking as he brought it closer to your body.
carefully, renjun began spreading the cold substance over the expanse of your legs with the brush, making you squirm at the tickling feeling. instead of snapping at you for moving around too much, he grabbed you by your hip, forcing you still.
“stay still,” he grumbled quietly from behind you.
“sorry, it tickles,” you bit your fist to prevent giggles from escaping you, trying your best not to thrash under the uncomfortable touch of the paintbrush.
renjun watched your muscles on your thigh tense up under the touch of the brush bristles, body instinctively moving away from the tool.
soon, the back of your lower body was covered in a nice layer of paint from your butt to just above the knee. you had gotten used to the tickling feeling of the brush and didn’t mind it anymore, so you had stopped wiggling under his grip, helping renjun paint the skin fairly quickly. there was still a big portion of your legs he hadn’t painted yet and the black paint tube was already halfway empty, so renjun had been right all along about needing more than just a single tube.
sitting back on his heels, he let his hand rest for a second before looking for more paint.
in the meantime, his eyes roamed curiously down your body, counting little moles he hadn’t noticed were there before. a quiet chuckle bubbled in his chest as he found one of the scars you had gotten during the skateboarding incident. without much thinking, his fingers caressed the mark in your calf as memories from that time popped on his mind.
“why are you stopping? the paint is gonna dry and we’ll have to start all over again,” your voice snapped him out of his daze making him nearly bump his head with your backside.
“y-yeah, i’m sorry,” renjun mumbled, stumbling to his feet to get the other tubes of black paint.
the boy moved around the room clumsily, almost knocking over the glass of water mixed with paint residue as he reached for the black labeled white tube. the red and black jacket he had worn to shield himself from the chilly weather no longer felt comfortable against his hot skin, so in one swift movement the piece of clothing was ripped from his body and thrown somewhere on the table.
in less than a second, renjun was back on his knees and ready to cover the remaining section of your legs in black.
you pretended you didn’t catch a glimpse of his toned abdomen as he got rid of the jacket, grabbing your phone instead just to find a couple messages from your friend.
from hendraryシ, 19:03 pm: did you get renjun to help you w that artsy tiktok?
from you, 19:16 pm: yep, he’s painting my legs rn
from hendraryシ︎, 19:17 pm: noice;)
deciding not to waste time opening the message to let kunhang know you had read it, you opted to open the black and white icon saved in your ‘social media’ folder.
while your best friend was busy enough not to notice, you pointed the phone down at the leg he was currently working on, making sure to get a good shot of the painting process without exposing yourself more than necessary. you really didn’t want to attract any creeps. though you tried not to make it obvious that he was in frame, renjun quickly noticed, looking up to throw you a glare and bringing the hand holding the paint tube over his face to cover himself.
“don’t be annoying,” he growled, clearly not happy with making an appearance on the video even if it was only for a few seconds.
oof, someone’s a little moody, you thought, putting the device down to not anger him further.
“but i have to show the whole process so other people can try it too! you do know how a trend works, right?”
“yeah yeah, whatever you say.”
renjun’s hands alternated between squeezing paint on your body and spreading said substance, setting a steady rhythm that allowed him to paint the rest of your body without letting the patches already covered in black dry just yet.
focusing on maintaining the tempo, he forced himself to keep his mind away from how smooth the skin of your legs felt whenever his hand accidentally brushed against it, or how the pitch black paint you had chosen matched your underwear.
“don’t you have a mirror laying somewhere around here?” you broke the silence, eyes wandering around every corner of the room in search of the mentioned object.
“i used to have one, but jisung broke the mirror we had at the dorms. so i don’t anymore.”
that kid, always breaking things.
you sighed, not surprised at all.
“can you take a picture then? i wanna make sure everything is nice and covered in paint,” you requested, fingers furiously typing on your phone.
“your phone or…?” renjun asked slowly, staring at the matching baby pink phone case you and kunhang had gotten as a friendship amulet the last time you had been at the fair with your friends.
initially, he had thought you were keeping the device close by and risking splattering paint all over it for the sole purpose of getting good shots of every part of the process. but the fast tapping of your fingers against the screen made it seem like you were texting someone and, if the look on your face meant something, you probably weren’t giving it up anytime soon.
renjun could only hope the person answering your messages wasn’t jaehyun.
“just use yours,” you shrugged carelessly, not bothering to look up from the device. “i won’t say anything if you keep the pictures anyway.”
a sudden coughing fit forced renjun to lean his upper body forward and bring his hands to his knees for support. his face heated up as he tried to breathe properly again. he couldn’t believe you had said that so naturally as if it was a normal thing for best friends to keep semi-nude pictures of the other on their phone.
“a-are you crazy?! how can you say shit like that so casually?”
he should have known better than to befriend a random stranger wandering outside of a walmart at 2:38 am.
renjun wiped his hand on the damp towel he used to clean paint stains before pulling his phone out of his back pocket, opening the camera and taking a few shots of your backside for you to see. handing you the device, he waited for you to give him thumbs up.
you muttered a ‘perfect’ before carefully approaching the white canvas laid on the floor.
“help me?” he took both of your hands in his, leaning his body slightly backwards so you could sit down without either hurting yourself nor ruing the canvas. “be careful and do it slowly,” you dragged the ‘o’ to make sure he understood correctly before throwing a half-joking, half-serious threat. “if you drop me i’ll kill you.”
“i know.”
once you were fully seated, you stayed still to let the paint stick to the fabric without smearing it.
while you waited, you glanced up at your best friend, scanning his figure for lack of a better thing to do. the boy, who stood just in front of you, stared at something on his phone, entranced. the squishy cheeks you came to know and adore looked less doughy, which made his face look sharper and more mature, and his legs, slim beneath the baggy cloth of his sweatpants, appeared longer than ever from your place on the floor.
renjun looked taller from that angle, and you weren’t going to lie, he looked pretty hot towering over you.
“you don’t seem 5’7 from here,” you hummed, satisfied with your observation, before your face lit up as a thought popped into your head. “you look like that daddy-longlegs spider i found on wikipedia that time we were searching for information on walruses.”
you snorted once you saw the sour look that took over his face.
you weren’t wrong when you thought this would be a fun activity to try out with your grumpy best friend.
“i’m just kidding,” you raised your hands in defence, “can you help me up now? please?”
slipping his phone back inside his pocket with a grunt, renjun took a step on each side of the canvas before putting his hands under your armpits to lift you up. setting you aside, he stared intently at the now black and white canvas.
he gulped, all the blood in his body rushed south and onto his dick, leaving him feeling lightheaded. his breathing suddenly got heavier as his eyes skimmed down the imprint of your plump ass and smooth legs.
the angel on his shoulder tried to fight the devil whispering in his ear to keep his eyes fixed on the painting, and it took every drop of self control in his body to tear his gaze from the canvas. the photo he took of your painted legs flashed behind his closed eyelids and he cursed himself for wearing sweatpants.
his mind ran wild with thoughts of your big doe eyes staring up at him, just like you had minutes ago as you innocently joked about his height, this time with his cock between your lips. his nostrils flared with a shaky intake of air as your tongue swept over the underside, teasing the vein.
renjun could almost hear your little sounds of pleasure, and if he didn’t know you were cleaning yourself with the damp cloth he had previously used, completely oblivious to the growing tent in his sweats, he would have swore they were real.
he almost bit his tongue when the thought of you, spread out across a table, fingers desperately running over your dripping hole before going to squeeze your breasts and making the skin of your chest glisten with your arousal, invaded his head. and he had to gingerly adjust himself in his pants, length resting against his hip with the tip held only by the waistband, to make his own arousal less noticeable.
the little problem inside his pants didn’t go unnoticed by his best friend’s curious eyes that were studying the look of utter devastation on his face before dropping lower.
suddenly, it no longer matter that the painting was still incomplete or how cold you felt without your leggings on.
there were far more important things to take care of.
“oh my god, so you’re telling me all this time i’ve been teasing you about liking my ass, you actually did? i was right all along?” you gasped in mock surprise, mischief shining in your eyes and a smirk playing on the side of your lips.
renjun’s head snapped up just to lock eyes with you. panic invaded his face, making the tips of his ears turn red in embarrassment, and he quickly looked down, heartbeat so erratic his body went numb.
oh no. oh no. oh no, no, no, no, no.
this couldn’t be possibly happening.
“i can explain.”
“can you?” you pressed, using a finger to lift his chin and stare straight into his eyes with a challenging look on your face. “what is it then, renjun? use your big boy words.”
you bit the inside of your cheek trying not to snort. the boy looked petrified, face pale as if he had just seen a ghost. his pink lips parted as his brain tried to untangle the jumble of thoughts that was his head, but not a sound came out.
“uh, yeah, i-i can. the thing is, well, your legs… yeah, your legs were, uhm, really soft and i think you're, yknow, really pretty… not like you didn't know that before, but, uh, yeah. i'm sorry,” struggling to find his words, your best friend apologized, visibly mortified. his head hung low and his fingers scratched the fabric of his black sweatpants, afraid that looking at you would only worsen everything. “i’m genuinely sorry.”
hearing his voice, dripping with so much guilt, almost made you regret teasing him.
key word: almost.
his features hardened as you coughed to cover the small giggles that broke past your pursed lips. his fists clenched in anger, skin prickling with humiliation as he silently stared at your cackling form.
renjun had to get out of this hellhole. fast.
“no! wait!” you rushed after him, grabbing him by the forearms before he could reach for his jacket to prevent him from leaving. what left you instead was your previous playful demeanor. “don’t go. i’m sorry for teasing you.”
your best friend kept his eyes glued to his shoes, still refusing to face you.
concern took over your face as renjun tried to snatch his arms out of your grasp, taking a step back to get away. and you stumbled forward from the force, nails digging into the flesh of his arm to both keep yourself from falling to the ground and force him still.
the boy looked like a distressed kitten lashing out with its sharp claws to make a threat back off.
his arm burned where your hands touched, and his erection twitched from the confines of his briefs at how soft and small they looked compared to his.
he needed to get away from you and the art studio. to go somewhere, anywhere, and forget this ever happened. the very last thing he needed right now was for you to touch him.
your proximity was unnerving and only added fuel to the fire.
“let me go.”
“no. if i let you go, you'll hide in your room and avoid me like the plague.”
shit, now he needed another plan.
“injun, that’s completely normal,” you reassured him, “i’d actually feel offended if you didn’t find me attractive enough to pop one,” you joked, trying to lighten the mood.
by now, you knew how your best friend felt about the situation. but, how did you feel? if the wetness starting to pool in your panties served as some kind of indicator, you could confidently say renjun wasn’t the only one affected. now that you thought of it, the outline of his clothed length was starting to look enticing…
“we can work through this, okay? you don’t need to run away from me,” you took a tentative step forward, fingers subconsciously squeezing him tighter.
he gulped.
if what it took to make renjun feel comfortable in his skin was for you to expose yourself and be in the spotlight, then that was exactly what you were going to do.
here goes nothing, you thought.
“also, it's not like i’ve never gotten a lady boner in front of you,” you offered with a sheepish smile.
renjun wondered how many times he had had you on his lap, acting as if nothing happened, all the while your panties were soaked in your juices. he wondered how many times you had felt so needy that you just wanted to grind against his thigh and get off by using your best friend’s body. or the countless times he had cuddled you on his bed, hugging your body close to his, that you wished he would fuck your frustrations away instead of forcing you to sit through hours of bad movies and random netflix shows.
how many opportunities he had unknowingly missed.
“you what?” his lips formed an ‘o’, “really?”
the surprised laugh he let out made you smile.
“i mean, yeah. believe it or not, this girl gets horny too. besides, it’s your fault for being so hot,” you pouted, poking him with your finger like you usually did.
he giggled like a child in a candy shop, grabbing his tummy where you stabbed him. his eyes shined as he held eye contact with you, feeling bold, and his pinkish cheeks wore a big grin.
cute.
“we can make fun of me together if that makes you feel any better. just please, stay with me.”
relief washed over his body, and he thanked every existing deity he could think of for shoving such an understanding into his life.
maybe being your friend wasn’t that bad anymore.
“thanks for not making it weird,” he offered you a grateful half smile and you just brushed it off.
“don’t thank me, friends are supposed to help one another. so, can i touch you now? please?”
renjun groaned when he noticed the way your thighs squeezed together, rubbing against each other to feel at least a tiny pleasurable sensation. his body leaned into yours almost automatically, as if it knew how to react to your advances like the back of his hand. he felt cold once your hands fell from his forearms, but it didn’t last long as one arm repositioned itself around his shoulders.
with your free hand, you tugged at the cloth of his shirt, silently asking to take it off. your best friend caught onto your intentions fairly quickly, parting away from you before pulling the piece of clothing off of his body. your hands caressed the smooth skin of his chest and abdomen and you bit your lip, enjoying how his toned muscles felt under your touch.
you took your sweet time feeling him up, letting your hand travel from his belly button up yo his shoulders and then to his jaw, delicately cupping his face. renjun’s bigger hand came to rest on top of yours, holding it to his warm, rosey cheek, and pressing his forehead to yours.
you looked up, surprised by the touch, to find renjun already looking at you. his eyes looked darker than you had ever seen before, chocolate orbs now an overwhelming pitch black. his unwavering gaze on you had you frozen in place, unable to break eye contact, as you waited impatiently for his next move.
when you noticed the way he eyed your lips, licking his to wet them, anticipation began building up in your stomach, making your breath quicken. in your trance, you didn’t realize how close your faces had gotten until you dared look down at his inviting, pink lips, minty breath fanning over your cheeks. you were so close his lips brushed against yours, noses touching in an eskimo kiss.
seeing as you didn’t back away from his advances, renjun slowly leaned in, head slightly tilted to the side and your eyes fell closed automatically. heart beating at an alarming rate, renjun copied your actions, closing his eyes tightly before eliminating the small space between your lips. next thing you both knew, your mouths had crashed together into a hesitant kiss.
renjun hoped you wouldn’t notice his nervousness, afraid of making you feel obliged to kiss back only to protect him –and his heart– from inevitable rejection. he couldn’t help but wonder if he was being too pushy, if maybe kisses weren’t something you just gave away to random people –and although renjun wasn’t a simple anyone to you, he still was just your best friend–, but only to the ones you offered your heart to. he couldn’t help but wonder if what he had just done was going to be the infamous bite of the forbidden fruit that would cost him expulsion from the eden that was your life.
thoughts twirled around his mind, making his eyes shoot open in panic to see yours tightly closed, face scrunched up. his stomach fell to his feet, regret bubbling in his chest as he realized he had crossed a line he wasn’t supposed to.
as renjun was about to pull away and apologize for misreading the situation, your arms snaked around his neck, hugging him closer. his soul came back to his body making him relax under your touch, a relieved sigh leaving his lips.
the combination of the minty taste of your toothpaste and the strawberry chapstick you put on all the time was addicting, and renjun found himself quickly falling for it. he swiped his tongue across your bottom lip, asking for entrance, and you happily accepted, parting your lips for him. the boy wasted no time invading the wet cavern, eager to taste more of you.
the kiss was slowly but surely turning more passionate as his hands felt your body and your own pulled him closer by the cheek. unlike other kisses you had shared with people throughout your life, this one was sweeter. the both of you were taking your time exploring one another, engraving in your brains everything about the other, enjoying the moment instead of rushing it. your tongues weren’t battling for dominance, but sharing it. shocks of electricity shot through your bodies, making you cling to the other, not wanting to let go so soon despite your lungs screaming for air.
once you finally decided to pull away from each other's lips to catch some air, his lips trailed down from your mouth to your cheek, to your jaw and down your neck to your collarbones. he softly kissed the protruding bones, before sucking rosey bruises that were soon to turn purple. your hands moved from around his neck to entangle in his hair, playing with the hairs at the back of his head, quiet moans escaping your lips.
you couldn’t believe how the boy that just a day prior was fighting you for the last gummy bear was the same person who was making you feel so good, so cared for and loved.
fingers toyed with the hem of your sweater, slightly tugging at it as he backed away from you just enough to look at your face. his sweet rosey cheeks and glossy eyes staring right back at yours stirred something within you that pushed you to impulsively rid yourself of the now annoying piece of clothing.
you watched as your best friend choked on spit, roughly coughing and punching his chest desperately as he fought for air. shock washed over his flushed face as his wide eyes gawked at your bare chest adorned with two pierced nipples, drool almost falling from the corner of his mouth.
“holy shit.”
questions swirled inside renjun’s bicolor head at such a rapid rate it was taking his brain longer than usual to process what his eyes were seeing.
renjun stood frozen, eyes fixed on your body and you shrinked under his intense stare, face burning with self-consciousness as you fought against the urge to cover yourself.
stuck on your internal battle, you didn’t notice the fucked out expression that had replaced the initial shock once he had processed what those tiny metal things were, nor the way his body reacted to them, pants tightening and feeling uncomfortably restrictive the more he stared at them.
“stop staring at me like i have three tits and touch me already.”
“i’m sorry, it’s just,” he wrecked his brain searching for the right words, still starstruck by the new discovery. “you look breathtaking.”
the sincerity behind his words took you by surprise. this wasn’t the first time your best friend had complimented you and yet this time something felt… different.
not a single one of your past hookups had wasted more than a few seconds taking in the sight of your body, like they were trying to memorize even the smallest of details. none of them had looked at you with so much admiration and genuine appreciation like renjun, your best friend.
“shut up, you're making me feel all weird,” you mumbled, looking away.
“just so you know, i mean it,” renjun offered with a smile, eyes turning into crescent moons.
and you could tell he did.
not even the bright artificial lights that illuminated the art studio could hide the way his face glowed under the moonlight, reflecting the way his heart fluttered from the inside of his chest.
you were such a pretty sight to see. even with your hair ruffled from taking off your top in such a hurry, lips swollen and glistening with spit, you still managed to make him weak in the knees.
without a second thought, renjun attached his mouth to one of your nipples, tongue eagerly lapping and swirling around it. he moaned loudly when the cold metal came in contact with his wet muscle, and the boy had to grind his length against your side to release some tension.
your hands dug into his hair, tugging slightly whenever his teeths scraped the sensitive bud, always careful not to hurt you. each pull of your fingers only pushed him to suck harder, grunting as he squeezed the other boob in his hand. he then released your nipple with a pop and switched to the other. as his mouth worked, he pinched the nub, rolling it between his index finger and thumb.
you were so wet already you could feel your juices running down your inner thighs. and renjun was no better; precum oozed from the red tip of his cock, making a dark spot form in the crotch of his sweatpants.
grabbing him by the shoulders, you pulled him up to connect your lips in a needy kiss, pressing your hips into his.
“do you think i could, uh,” suddenly feeling shy, renjun hesitated to ask, taking a step back to look at your face while rubbing the back of his head bashfully, “would you let me go down on you?”
your face lit up, eyes sparkling under the lights of the art studio, reflecting the whole universe on them, as if he was the one who hung the moon and the stars in the sky.
a small smile formed on his face as you turned your body around without a word, supporting yourself on the table before glancing back at him with an impatient expression.
this time, as he was allowed to stare, renjun enjoyed the view.
“please.”
renjun was quick to kneel behind you, forcing your legs apart, warm palms gripping your cheeks to keep them spread, ready to shove his tongue between your legs. your fingers curled into fists, excitement pooling at the pit of your stomach and making your body feel on fire.
your body trembled, thighs quivering, when the wet muscle licked a stripe up your clothed core, nose buried between your asscheeks. spit and arousal dampened the cloth, making it stick uncomfortably to your lower lips.
before you could protest, teeth sunk into the clothed flesh. a shiver ran down your spine at the same time your stomach did a somersault, and renjun had to hold you still by wrapping his arms around your thighs to stop your body from shaking.
“r-renjun,” you moaned shakily and he only grunted in response, lapping over your aching pussy, clenching pathetically around nothing. “please, do something already.”
his confidence skyrocketed the moment you mewled his name, your voice dripping with desire and sounding so dirty yet so sexy. he shifted uncomfortably from his place on the floor, and not exactly for how sore his knees were starting to feel. the way your body reacted to his touch, arousal completely soaking your panties and ruining them for good as your hips pushed back into his mouth for more, had his hips subconsciously humping the air.
“but i was having so much fun,” renjun sighed, seemingly disappointed. but he wasn’t able to fool you; you could feel his smile against your skin.
though that pretty smile of his didn’t last long, it fell really quick with a simple –rather rough– tug of his silky brunette and blond locks.
“ouch!” the boy whimpered, reaching a hand to sooth the sharp pain coursing through his scalp, “jeez, woman.”
you heard a low mumble of ‘so damn violent’ that renjun had probably hoped was quiet enough for your ear to be not able to catch it. but since the place was completely deserted of people other than your best friend and you, his words could be easily heard in the silence of the night.
“so now i am the violent one?”
so now he was going to pretend he didn’t almost choke one of his friends for stealing one, just one, of his thousands of tea bags?
you rolled your eyes, scoffing a little at your friend’s hypocrisy.
for the second time, he reached for your underwear, this time with the intention of getting rid of it. you felt the ruined cloth run down your legs until it was left pooling around your ankles. renjun sucked on a shaky breath, pupils blown wide with raw desire, as his fingers uncovered your soping core. his tongue, suddenly heavy in his mouth, gave your slit a tentative lick, and a throaty groan got stuck in its way out at the taste.
sweet.
that’s how you tasted. sweet like a cup of homemade hot chocolate, three marshmallows floating on the surface, crushed candy canes melting at the heat; sweet like one of those cherry lollipops you used to suck on when you both were in high school –an image that would haunt him until the beginning of his adult years in form of wet dreams–; sweet like peaches and cream on a spring day.
his eyes fell closed as his body leaned further into you, hands returning to their place around your thighs and tightening their grip on them. he hummed in content, skilled tongue swiping left and right, not leaving a single spot unattended.
your clit throbbed, desperate for any kind of attention, so one of your hands travelled down your body to press the heel against the bud. although you thought the subtle roll of your hips would go unnoticed, it didn’t, and renjun didn’t like it. the day he had unknowingly been waiting for had finally arrived, and he was determined to make you cum on his own. so, detaching an arm from around your leg, he slipped it between your thighs until he reached your hand, ripping it away from your body in a fast movement.
a squeak got stuck to your throat as his own hand came to replace yours, the pads of his fingers circling over your clit. the jolt of pleasure his touch sent through your body had your now free hand travelling to your breasts, rolling and pinching one of the hardened mounds as sighs escaped your lips.
“s-shit, just like that.”
tongue flattened to give wide strokes, renjun slowly licked your folds, just as he would do while eating ice cream. he ate you out like a starved man on the brink of death, slurping your juices like he was never getting a taste of you ever again.
but, as good as his mouth felt on you, you were dying to feel the burning stretch his digits or cock could provide you. you were going to get just that and you wanted it now; you weren’t going to accept anything less.
“y-your fingers. i need your finger.”
once renjun got back to his feet, his fingers wasted no time in sliding between your swollen folds, gathering all the slickness he could before teasingly pushing them against your entrance. you wiggled your hips, pushing them into him in desperation.
“cut the crap, you fucker,” you grumbled angrily, curling your fingers around his wrist to force his hand closer to where you most needed him.
he must have pitied you, since less than a second later two fingers were shoved into you until they were knuckle deep inside your slippery hole. a throaty groan was heard coming from behind you and you whimpered, finally getting some of the stretch you craved so badly.
renjun thrusted his long digits, curling and scissoring, pumping them into you as he would when fucking you with his cock. if you were so tight around two fingers, he could only imagine how cramped your pussy would feel stuffed full with his cock. he bit his lip at the thought, hardening length pressing to your thigh as his eyes rolled back.
fingertips danced along the expanse of your thigh before lightly scratching the smooth flesh as his other hand fingered you, preparing you to take his full size. with every pump of his fingers he hit deeper inside you, the only purpose on his mind being finding that sweet spot that had you screaming your lungs out. and once he found it, he abused it as he pleased.
“look at me,” renjun demanded, hurrying the pace of his thrusts.
you struggled to keep your eyes open, the upper half of your body twisting uncomfortably as you made an effort to face him.
“come on, look at me.”
you managed to hold his gaze, letting out whimpers.
“i think i’m close,” you breathed, and he instantly withdrew his fingers from your dripping core.
while you tried to catch your breath, his hands went to unbuckle his belt at the speed of light, fingers twitching as his mouth watered at the thought of being inside of you. he let his pants rest on his thighs, not bothering to take them completely off.
in his hurry, he didn’t notice the mischievous look in your eyes.
“cute boxers, by the way.”
of fucking course.
of all days, today was the one he had to slip on his most embarrassing –but favorite– pair of boxers.
but, in his defense, how would he have known someone was going to see them, anyway?
he was supposed to spend his saturday night chilling at the studio, on his own, since taeil had finally trusted him unsupervised with the keys. renjun could have never guessed you were going to tag along now of all times. after all, you had popped out of nowhere as he opened his front door on his way out.
and how could he deny your company when, for the first time, you showed excitement as he told you about this new idea of a painting he had been meaning to try out for a while now?
his face flushed a bright pink color, and the gasp that left his lips quickly turned into an exasperated groan. why did you have to be so annoying? couldn’t you just shut up and let him fuck you in peace?
damn.
“oh my fucking god,” renjun shook his head, eyes closed in humiliation, “ i can’t do this. i quit. i’m leaving.”
“aw, injunnie, don’t be a crybaby,” you giggled sweetly, looking into his deep brown eyes with the best doe eyes you could muster, eager to rile him up. “i’ll pretend i didn’t see the cute moomin pattern on your undies and we can get right back to it as if i had never said anything in the first place.”
“i hate you so fucking much, i’m literally going insane.”
while renjun was too busy complaining to pay you any mind, you approached him and snaked one arm around his shoulders, eyeing the tent on the front of his boxers. the boy flinched, hissing under his breath when you cupped his painfully hard length, slowly beginning to palm him over his clothes. a rush of arousal shot through his body and he twitched in your grip, head falling onto your shoulder in bliss as quiet whines slipped past his lips, finally receiving the pleasure he had been neglected since things got heated.
spitting on your palm, you slid your hand under his boxers and wrapped your lubed fist around his thick length, squeezing the base. his hips writhed under your touch, rutting into your closed hand to get more friction.
“hurry up, i want you inside of me,” you urged him, pumping your hand at a slow pace to lure him into fucking you and the boy almost sighed in relief when you didn’t ask to take him in your mouth. he was more than sure he would bust a nut as soon as your swollen lips wrapped around him from how desperate for your touch he felt.
as much as he wanted to give in to you, renjun couldn’t ignore the way his stomach twisted and turned at the thought of crossing lines best friends weren’t supposed to. if he thought kissing you could change things between you two, he was wrong. even after eating you out, things could come back to where they once were with less of a ruckus, but after sticking his dick inside of you? he wasn't sure he would be able to act normally around you ever again.
this was the last turning point before a road straight to broken friendships.
and heartbreak.
“are you sure you want this? we can stop here, we don’t have to go any further. y’know, this could chang-,” renjun began voicing his worries, but was cut off by your lips against his.
“i know, but i trust you. i care about you and our friendship more than anything in this world, and i wouldn’t have let this go so far if i thought it could break us apart,” your voice was soft, reassuring. “do you trust me? don’t feel pressured, tho, we can always stop here and pretend it never happened.”
renjun didn’t want to pretend tonight never happened.
“i don’t,” your smile faltered, “i trust you.”
your best friend swallowed your relieved sigh, engulfing you in his loving embrace.
soon after, renjun lifted your leg. the head of his cock nudged your sopping core before sliding the whole length of it along your slit to coat himself in your essence, spreading the beds of his own arousal all over your folds. he lined himself with your entrance, feeling the muscles on his abdomen contract as he pushed his hips forward, easing into you with a groan.
his head lolled to the side as he leaned over you, pressing you into the edge of the table for support, body feeling weak from the crushing tightness your warm walls provided.
“t-too tight, fu-fuck.”
chewing on his bottom lip as he sucked in shaky breaths, renjun struggled to stay focused. his cock throbbed as he tried to reach deeper, wanting to be buried to the brim inside you.
whimpers escaped you as you were unable to keep your mouth shut, eyes fixed on the beautiful boy in front of you. his dark brows were scrunched in a frown, eyelids squeezed shut and lips pursed to maintain his sounds at bay, and you wondered how could someone be so angelic and real at the same time.
letting you adjust for a second, he let his other hand caress your sides, focusing on rubbing lovingly circles on your hip with his thumb instead of the squeezing of your walls around him. the soothing feeling of his strokes helped you relax, and you leaned forward to rest your chin on his shoulder with a content hum.
once you felt ready to be ravaged by your best friend, you left a kiss on his neck and a quiet whisper of ‘i’m ready’. he then rocked his hips slowly, allowing you to feel every pulsing vein of his cock as he pushed your walls apart. the pain in your core was nothing more than a burning sensation that soon turned into pure pleasure, and you shifted to meet his thrusts.
“you feel so good,” you breathed against his cheek, lips placing pecks down his jaw, and he bit his lip with satisfaction, a small smile creeping onto his face.
“i know,” his chest filled with pride at your praise.
“if i had known you were gonna get all cocky and act like a jerk, i wouldn’t have said anythi-,” you started, rolling your eyes with a grumble.
but you never got to finish.
as if testing the waters, renjun let his hand spank your asscheek, leaving a –rather delicious– stinge on the abused skin that forced a surprised gasp out of your lips.
“what was that for?” you huffed, digging your nails on his broad shoulders and throwing his way the most annoyed expression you could muster while getting split open by your best friend’s fat dick.
“i just thought you’d be into that, y’know, since you’re into marking and all that stuff.”
“what does that even mean?” you demanded an explanation, angling your elbow in a threatening way so it was ready to prod the boy in the stomach if he had the audacity to comment something similar. “are you seriously kink-shaming me right now, you little piece of shit?”
as you were reconsidering your whole friendship, renjun only shrugged it off, seemingly entertained.
“take it as you will.”
you squeezed around him in retaliation, the grip almost cutting his blood circulation from how strong it was, and you cursed him under your breath with a frown. renjun didn’t seem to appreciate your attitude, as he decided to drop his grip on your leg and manhandle your body so your back was pressing against his chest.
“don’t fucking try me, y/n.”
the growl that vibrated through his chest sent a shiver down your spine and the humourless tone of his voice made your breath stutter.
“i-i’m sorry,” you offered in a small voice, biting back a whimper.
“hm, that’s what i thought.”
renjun pulled out enough for the head of his cock to be the only part of him remaining inside of you, before slamming back in. your eyes shot open, jaw going slack as his tip hit your cervix. your mind blanked out, any possible thought rushing through your head coming to an abrupt stop.
using your dazed state to his advantage, he reached for the white paint tube you had used earlier.
you sighed, shivering when the cold paint slid down the valley between your breasts. rejun caught it midway with his bare fingers, spreading the paint all over your chest and abdomen, hands fondling your boobs, pinching your sensitive nipples. a pair of soft lips ghosted over the exposed skin of your neck, hot breath making the hairs at the nape of your neck stand up.
hot and cold.
the contrast in temperatures felt intoxicating, leaving your head spinning, mind hazed by the new but not unwelcome feeling.
his fingertips left a trail of fire everywhere they touched, goosebumps arousing on your skin with every sweet stroke. renjun never stopped working his hips, each thrust carefully calculated as to hit your sensitive spot, making you sob in pleasure.
after a few more pumps of paint, your upper body was completely and evenly covered in white, but renjun wasn’t done just yet. he reached for your hands, intertwining your fingers with his and smearing paint all over them as well.
the intimate touch brought you down to earth, making your head snap to the side, brows furrowed with confusion. renjun wasn’t used to holding hands with you, it was a line neither of you were ready to cross just yet. or so you thought.
his hand felt pleasantly warm against yours, and that same warmth spread across your whole body, warming your cheeks in the process. sadly, you didn’t get to enjoy the gentle feeling for too long, since a couple of seconds after initiating the touch his hand left yours to press his palms on the black canvas laying on the table.
with a particularly hard thrust, your body jerked forward. your hands found a new place on each side of his to ground yourself, arms weakly supporting you. his form hovered over your smaller one, forcing his sweaty chest flush against your bare back and squeezing the whole of your upper body into the canvas in the process. your sticky torso smeared white paint all over the black-painted cloth, staining it with the outline of every curve.
his hips never faltered, pounding into you from behind, and he made sure to keep your body immobile against the canvas to not mess up the perfect imprint of your chest.
“fuck me harder,” you cried out, hand covered in dry paint going to grab his forearm. “i need more.”
“what do you mean harder? am i not fucking you hard enough?” renjun scoffed, offended, giving your asscheek another harsh slap.
you pushed yourself up to rest against his body, face sweaty and brows furrowed, and whimpered, panting heavily as your lips searched for his. you wanted to feel him, all of him, closer, deeper. he smiled and connected your lips in a passionate kiss, heart skipping a beat when your hand caressed his cheek lovingly.
your head fell onto his shoulder as renjun began picking his pace, starting to roughly ram his hips into your ass. clapping noises filled the room, both from the way his thighs slammed into yours and from the sporadic spanks, and he swallowed your moans.
renjun tried his best to focus, to hold on a little bit longer and feel you cum around him, squeezing so hard he wasn’t able to move. he breathed deeply, thoughts of you screaming his name as you milked him dry as your face contorted in ecstasy convinced him not to let go just yet. but you were bringing him closer to his limit with every clench of your walls.
sadly, having your hands covered in paint, even if dry, meant none of you was able to attend your clit and speed up your high.
“i’m, f-fuck, i’m close,” renjun announced between ragged breaths, hugging you impossibly closer to his body.
he struggled to breathe like a fish out of the water, and you were sure you would find bruises on your sides from how strongly his fingers were clutching at you.
“i hope your pull out game is strong, bud,” you snickered through gritted teeth, walls fluttering around his cock and drawing a groan from the back of his throat.
for a second, it felt as if you were just playing around with your best friend, like you always did, and if it wasn't for renjun pounding into you from behind, you would have probably teased him further. but you couldn’t think of a sharp-tongued comment to throw his way, or even force more words out of your mouth. not with the way he was making you feel. with every snap of his hips, your chuckles got stuck to your throat, one after another, successfully sealing your mouth shut.
renjun didn’t reply. instead, he grabbed you by the waist, digging his fingers in the soft flesh. his thrusts became sloppier soon after, giving harsher strokes that forced him to reach deeper inside of you. his head came to rest on top of your shoulder, before attaching his mouth to your neck, sucking on the skin only to kitten lick the abused spot afterwards.
it didn’t take long before he forced himself to slip his cock out of your tight, warm insides, letting it rest between your cheeks. renjun swallowed the disappointed whine that was threatening to escape his lips, already missing the feeling of your walls wrapped around him, sucking him in as if you never wanted to let go.
shaking his head to get rid of any thought, renjun turned his attention to the task in hand: his release. putting his hips back to work, he grounded against the plump flesh of your ass. his hard length slid up and down with little to no resistance from the amount of arousal coating it.
eventually, he was able to regain the same pace as before when he was inside of you, slapping noises increasing as the seconds passed. the room was engulfed in a burning heat that had your skin sticky with sweat.
his mouth fell open, small puffs of air slipped past his parted lips, wet tongue darting out to wet over the chapped skin. sweat started forming on his hairline from the effort, some droplets slid down the side of his face from the effort. his arms wrapped around your waist, lips pressed to your jaw, peppering kisses down to your neck as his hips worked ruthlessly, rutting against you as if his life depended on it.
renjun was close, so close to finally bursting, cock throbbing uncontrollably against your wet skin. he could almost taste his release, jaw clenching as he chased after it with every ounce of energy left in his body.
a couple of thrusts later, he nuzzled his face into the crook of your neck as spurts of hot, sticky cum painted your lower back, your name mixed with fell from his lips. his hips halted their movements, settling with squeezing yours against the table in front of you and sinking his teeth into the expanse of skin where your shoulder and neck met with a groan.
that was certainly going to leave a mark.
you squeezed your eyes shut, bottom lip caught between teeth, as your head fell back onto his shoulder to give him better access. his lips ghosted over the redish bite mark before letting his nose rub softly against the shell of your ear, leaving one last peck on the area behind your ear.
a couple of seconds was what took renjun to recover from the intense orgasm he had just experienced. feeling out of breath, he dropped most of his weight on you, only holding himself on his forearms to prevent his body from entirely crushing you under him. a huff left your lips, gripping his arms and trying to stand up straight, though it was proving to be harder than you initially thought.
not wanting to appear inconsiderate, your best friend lifted his body from yours.
“come here,” renjun urged you, already back on the floor. excitement coursed through his veins, making his body tremble with a light buzz. his knees were most likely going to be sore later from the rough flooring, but the memory of your sweet taste pushed the thought to the back of his head in less than a second.
so, not wanting to make renjun nor yourself wait any longer, you moved forward, closer to where he was kneeled. he quickly reached for your leg, hooking it over his shoulder so his mouth was scarce inches away from your pussy, before inhaling deeply. you looked down at him as he licked a stripe up your thigh, collecting the juices dripping down your inner thighs with his tongue. his cock twitched from its confinement at the lingering salty taste, a quiet groan falling from his lips. there was something undeniably sexy in tasting himself on you.
his lips closed over your sensitive bud, and your hips jolted forward as he sucked on it, fingers covered in dry white paint falling to his hair for support. he looked up at your face with a grunt, releasing your clit before using the tip of his tongue to rub circles around it. his fingers twitched, aching to feel your wetness once again, but he contained himself, settling with using only his eager mouth.
your back arched back at the pleasure building incredibly fast in your lower belly, your orgasm approaching as fast as it drifted away minutes ago.
“fuck, renjun. don’t stop, i’m so close,” you struggled to get out, full body trembling at the intense rush of arousal flowing through you, the knot in your stomach tied so tightly it was threatening to snap any time now.
obediently, he began sucking harder over your swollen clit, circling it with the tip of his tongue before nipping on it. moans continuously broke past your lips, red and swollen from kissing, as his tongue swept between your folds.
praises bubbled inside renjun’s chest. he wanted to tell you how pretty you sounded moaning his name like that, thighs quivering in ecstasy; how much he would love to listen to your sweet little sounds of pleasure all day long and watch your face as you came. he wanted you to see yourself through his eyes; like the most beautiful work of art in the museum that was life. but he kept the praise words to himself, afraid it would only make things weird. or even more so. especially after your bashful reaction to his last compliment, the last thing he wanted was to make you feel uncomfortable.
three more flicks of his tongue was what did it for you and soon, you found yourself reaching heaven, fingertips reaching out to graze the clouds. your vision turned blurry, the crushing feeling forced you to put a hand back on the table to hold yourself up. eyes fixed on you, renjun watched as your head lolled back, eyes shut tightly and face scrunched up in bliss. he felt your body tense up, pulling him closer with your leg, and he just let you ride his face as you wanted. your hips rocked wildly against his mouth, entirely covering his chin with your sweet cum.
renjun gratefully took everything you had to offer, drinking in until the very last drop and licking his lips as if you were the most delicious meal he had ever had. he lapped your gushing pussy clean, relishing the taste as long as he could, until you were whimpering in overstimulation, using your hold on his hair to try to pull him away.
“i have to admit, that was pretty intense. i didn’t know you had it in you, huh?” you chuckled breathlessly, slipping into your leggings without bothering to put on your ruined panties. “seems like you’re a box full of surprises.”
the casual tone of your voice felt comforting, and made his body relax, lips turning upwards in a lazy smile. it confirmed nothing had changed in your friendship, which was like a burden had been lifted from his shoulders, though he couldn’t shake off the strange sense of disappointment in his chest.
“there’s a lot of things you’ll discover about me if you spend more time here at the studio.”
you grabbed the damp towel that you and your best friend had abandoned on the table once things got heated and proceeded to remove the white paint from your body.
“we spend more time together than we do on our own. sometimes it almost feels like we’re married or something,” you giggled, eyes turning white with mocked annoyance, and his heart did a somersault. “also, i may come around someday. it actually isn’t as boring as it seems. at least when you’re not just sitting there, staring into nothingness.”
“you just don’t understand the creative process of an artist,” he snatched the towel from your hands once you had cleaned yourself to do the same.
“that’s so not true! i think i’ve spent so much time with you already that this artistic thing is rubbing off on me.”
“sure. once you finally get how the color wheel works you can come back and talk to me,” he teased, pulling up his pants and boxers before buckling his belt.
“asshole.”
you and renjun stayed quiet for some time after that, just enjoying each other’s company. he paced around the room, collecting his shirt and jack before throwing them on, his back turned on you as if you hadn’t seen him naked already.
“oh shit, i never got to finish the painting,” you pouted, staring at the canvas on the floor, phone once again in your hand. “and whose fault is that?”
with your eyebrows raised accusingly, you put your hands on your hips, like a mother lecturing her child.
“don’t look at me like that! i literally tried to leave but you wouldn’t let me!”
the boy had a point.
“whatever,” you mumbled, going to grab the paint brush and more black paint to finish the job.
renjun took it upon himself to clean up the tools and other materials while he waited for you. after walking in and out of the storage room on at least five different occasions, he checked the time on his phone and ‘22:36 pm’ in big white font was what read on the screen. he hurried to grab your things so you could leave the studio together as soon as you finished, it was dangerous for you to be out and about this late at night.
“okay, i’m done. let me just film a few more clips and i’ll finish the whole thing once i get home.”
your best friend nodded and took the canvas from the table to hang it up and free up some space.
that night, renjun left the art studio with a sinking feeling on his stomach, and the cause wasn’t unknown to the boy. although you hadn’t shown any sign of regret yet, he was understandably worried for the turn your relationship would take in the long run after being literally balls deep inside you.
as he walked you home under the dark sky of the night, side by side with you, he feared he had committed the worst mistake of his life. one that could potentially cost him his friendship with you, that could break the delicate threads of your bond that he spent years oh so carefully building. you were so important to him he wouldn’t know what to do if you decided to cut ties with him.
as he laid in bed with a heavy heart, he thought about everything that had happened, from the moment you had asked for his help on the challenge to your face as you rode his face.
for the first time, he felt lost, unsure of your feelings. he wanted to know your take on the whole situation. would you want to pretend you didn’t fuck your best friend and forget that night ever happened? would you acknowledge the passionate moment you both shared at the art studio and just remember it as an experience that brought you two closer and strengthened your friendship? would you perhaps regret it? the amount of possibilities, both good and bad outcomes rushing through his head had renjun feeling dizzy.
only hours after he had managed to fall asleep, the vibration of his phone woke him up from his slumber. renjun groaned as he felt the bed for his phone, quietly cursing himself for forgetting to turn on the ‘do not disturb’ feature before going to sleep. frowning, he checked the time to realize it was only 6 am. it was way too early for his friends to be already up and about on a sunday morning. anyway, he unlocked the device to find a message.
from na jaemin, 5:56 am: dude check out your girlfriend’s latest tiktok👀
from huang renjun, 6:02 am: what the fuck, jaemin
from huang renjun, 6:02 am: it’s 6 am
from huang renjun, 6:03 am: leave me alone
from na jaemin, 6:04 am: i woke up early to exercise w jeno ofc
from na jaemin, 6:04 am: you should probably start to do so too, spaghetti boyy
from na jaemin, 6:05 am: i’m pretty sure y/n likes ‘em chunky
from huang renjun, 6:08 am: fuck you, dipshit
from na jaemin, 6:09 am: stop being such a buzzkill and just check it out
this better be worth the hassle or else he was whooping jaemin’s ass back to dreamland.
opening the almost completely abandoned app on the device, he searched for your account –which was conveniently his latest search– and scrolled down until he came across your most recent –and popular– tiktok. ripping the band-aid all at once, he clicked on it.
“what the hell?” renjun gasped, suddenly very awake.
your ‘stupid idea’ had three million likes.
the first thing he saw as the tiktok started playing on his screen was a short clip of the art studio with the words ‘so i decided to try out the body art challenge’ in white. nothing weird, just the announcement of what you would be doing during the rest of the video. the clip that followed was zooming into renjun’s face while he distractedly cleaned up his brushes and had ‘with the help of my best friend’ written on the lower corner of the screen.
up to that point, renjun still couldn’t understand the gigantic amount of attention you had gotten just by posting a simple video.
clips of the materials and the process of painting the canvas flashed by without catching his attention, until the sight of his annoyed face appeared on the screen once again. renjun cringed, cheeks flushing, as he watched himself paint your leg not even an hour before having his tongue shoved down your throat.
well, that escalated quickly.
next thing he knew, the canvas with your ass and legs printed in black paint popped up on the screen of his phone, and he had to pause the video to rub his eyes, unable to believe what he was seeing.
in the process of innocently showing your viewers the studio and your painting, you had also accidentally caught on camera something that none of them was supposed to see. there, in the background, stood renjun semi-clothed for a good five seconds before slipping his shirt back on.
and that wasn’t even the worst part of it all.
your camera had done a great job capturing in high definition the red trails your nails had left all over his shoulder blades and back during your ‘bonding time’.
his cheeks reddened almost immediately and he groaned in embarrassment as blood rushed to his crotch at the memory of the night before.
the last clip showed a bright grin on your pretty face as you waved your viewers goodbye. even though you tried to cover it with your hair, renjun could still see the reddish bruise his teeth had left on the skin right below your jaw. and to top it all off, the wall behind you had renjun’s canvas hanging on it.
of course, it couldn’t just end there. no.
his eyes almost popped out of their sockets as he opened the comment section to find seventeen thousand comments.
“crap.”
its_taeil_time: i’m never leaving you alone at the studio again. ever.
yourfullsunhyuck: ooOOH you kinky lil fuckers👀
with_jaem_inthemiddle: i hope you kids used protection
y/n: what the fuck, jaemin, we’re literally older than you
morksmisfits: dude what happened to your back, did one of jeno’s cats attack you again?
foreignswagger: so… who’s gonna tell him?💀
its_chenji_not_jichen: holy guacamole, what the hell happened to you?!
ty_track: jisung, i told you to get off this cursed app
its_chenji_not_jichen: this is a free country
ty_track: chenle, you better stfu or istg i’ll beat your ass
johnsbanana: is that why neither of you were picking up my calls? teenagers this days
y/n: uhm, excuse you? we’re adults ._.
johnsbanana: adults my ass, you both act like children
y/n: sit down, granny
foreignswagger: i can’t believe you’ve done this, i am d i s g u s t e d
jenojam: i feel like i shouldn’t have seen that, i-😭 mom, pick me up, i’m scared
with_jaem_inthemiddle: omw
y/n: @with_jaem_inthemiddle i thought he said mom, not bf👀
yourfullsunhyuck: oOP-
princedonkey: did the ✨whoohoo✨ part happen before or after you were texting me?
y/n: great question, dorothy ¯\_(ツ)_/¯
–lia:)
✨[ 22:53 pm ] – q.k.✨
© sparklysung – 2021. all rights reserved. no reposts, modifications and/or translations allowed.
note – so ig i’m back? after a long disappearance (i’m so sorry idk why i always do that, not only w my blog but like w everything, i just disappear from the face of earth lmao) i’m finally officially back. 2nd semester starts on monday tho so pls pray for me. anyway, this is the edited version of something i wrote for a friend and since i’m sad i haven’t posted anything in so long i decided to release it now. pls excuse any mistakes and hope you guys like it!♥️
[established relationship!au ; big dick!dom!kun, sub!reader, pet names, some spanking, daddy kink, praise kink, nipple play, marking kink ; 859 words]
you sat on kun’s lap, his fat cock plunged deep inside your core. a funny feeling on your stomach made you squirm around, causing your fingers to curl and straighten in an attempt to keep yourself grounded.
you whined quietly, waiting for him to move and fuck you as he normally would. but he didn’t. instead, he looked expectantly at you, brows quirked in a teasing manner.
“what is it, baby? why are you so pouty? i thought this was what you wanted.”
and he wasn’t wrong.
you had pleaded him to let you be on top, just for once. you were always the submissive one in bed, and don’t get things wrong, you liked it that way. god, there was nothing you loved more than to be fucked dumb by your hot boyfriend.
but still, sometimes you wondered how he would look like laying on your shared bed, helpless and sweaty under your prying hands. more than anything, you wanted to feel him grab your thighs with his bigger ones, squeezing the soft flesh until bruises adorned your skin and groaning in pure bliss as you bounced on his dick. just thinking about the sinful sight had your breath hitching in your throat.
you gulped, glistening lips forming a cute pout on your face. “daddy, please,” you clenched around his cock to get him to do something, face burning with embarrassment, but he only chuckled.
if you were being honest, you had expected him to take control of the situation after some time of you bossing him around and fuck your brains out, thrusting his hips up into yours hard and fast –just how you liked it– until you were nothing but a whiny mess.
you didn’t appreciate at all the unexpected turn of events.
“what does my baby want?” one of his big hands squeezed your thigh, while the other forced your hips to start moving on his dick. “you want me to fuck you?” he asked, biting back a satisfied smirk, and you nodded eagerly, lip trembling slightly under his intense stare. “if you want me to fuck you, you’ll have to show me you deserve it in the first place. ride me like the good girl i know you are.”
kun sat back and relaxed against the headboard, calmly scanning your expression for a hint of what was going on in that little head of yours. although you tried to put on a neutral face, you couldn’t deny the way his words excited you. it was incredible the amount of control kun held in his hand without even trying. you could be the one on top but he was the one who called the shots after all.
so, without putting much of a fight, you lifted yourself a bit until only the head of his cock was left inside of you before dropping all your weight down, letting him slide all the way in once again. the deep groan that left his chest egged you on to fuck yourself on his cock to your heart’s content, so you let yourself enjoy the feeling of his tip kissing your cervix. he reached so deep inside of you it made you see stars dancing behind your heavy eyelids.
whimpers and moans fell from your lips as his eyes stayed trained on your figure, on top of him, breasts bouncing with your every move. your thighs burned and your legs shook with exhaustion, body feeling weak, as you tried to keep up your rhythm.
you threw your head back when you noticed the big smirk plastered on kun’s pretty face. a cry of his name left your lips when his hand that was previously caressing your thigh landed a playful smack on your ass. he hummed in satisfaction when you picked up your pace, rolling your hips with newfound vigour, mouth hung open and struggling to maintain your eyes locked with his.
sweet little praises left your boyfriend’s swollen lips, basking in the way your body reacted to his ministrations before he sat up to capture a nipple with his lips. the new sensation caused your hips to falter, back arching into his mouth with a loud moan escaping your chest before you could stop it.
“enjoying yourself a little too much, huh?” you felt him mumble against your chest, breath fanning over the wet skin and making you shiver. not expecting an answer from you, he began sucking on the sensitive bud, alternating between both tits and making sure to leave pretty bruises all over the valley of your breasts for you to find in the morning.
kun didn’t even need a verbal warning of your nearing high, he could tell through your body language. only a couple of seconds later you found yourself coming around his cock, squeezing him, trying to milk him dry. the clenching of your walls triggered his own orgasm and he was barely able to pull out before tipping over the edge, abs flexing with every rope of cum that landed on your asscheeks, leaving you both panting heavily.
“i hope you’re ready for your reward, baby, because i’m not holding back.”
–lia:)
Culture Things. [M]
Genre: Dystopian, AU, SMUT, non-idol, angst, fluff
Pairing: NCT x OC
Warnings: None for this chapter <3
Word count: 2.4k
Summary: Zennie’s dreams of entering the walls are finally coming true. But she is about to also inherit a group of men who all have one common goal in mind.
A/N: Okayyyyy so I’ve been working on my ideas for this fic for a long time. My inspirations for this were this book called The Giver as well as the concept for NCT’s Universe. I think it was just so well thought out…. But anyways….. you all should know that this story will be pretty long. I’ll be updating whenever I can and the story could start a little slow~ Pls bare with me. Thank you so much to everyone who takes the time to read my stories and please don’t hesitate to leave comments and show love! <3
Keep reading
DILF!JAEHYUN AAAAAAAAAAPLPSOXOOSWYFGCUCTX VUIBUVUVXYXHCHVICXCVOLWLWKSLDKXKSKSMWKLSODXOSOEKWKWJWHJSISOSOSOSKLWLSLSKSJSKSKSKSKQKKSKSKDKSKWKWKSKDXKXKIXOSPWPEPEMWNBGYYIWKKWKWLSDLSKQLMQNKWLWPWLWKKSIXKSKMWKWLSLKSKSKWMSKSKSKSKWKSKSKSLSWLLWLWKSKXKXKJSKWNWKSKSKZKAKSKSKSLSKWKSKSKSKSKSKSKSKKSKSSJQJWJWJSJSBBS
trick or treat - j. jaehyun
→ jeong jaehyun x neighbour! reader
-> dilf! jaehyun au
→ CW: dom! jaehyun, breeding kink (jae's horny, i'm horny, everyone if fucking horny), age gap (reader is in mid-20’s and jae is a divorced 29yo Jae), unprotected sex, creampie, fingering, handjob, oral (f receiving), praising, pussy slapping, biting, spit kink, oral fixation (jae), there are some cringey lines (i'm sorry but i wanted to have them in there but i didn't know how else to phrase them T-T), jae's thick in this one guys :D
-> a/n: omg haii ^-^ okay so this one isn't necessarily halloween related but his kid in the fic is going trick or treating so it counts!!! Jae is DOWN BAD in this one y'all. also just an fyi, this one has a lot more dialogue since they have more of a relationship and it's not just mindless sex this time?? but there still is quite a lot of sex??? okok enjoyyyyyy
-> wc: 6k
-> upcoming: switch! yuta (playboy yuta :) will explain more on that later) psst! requests are open!!
“You’ve got to be kidding me.” Jaehyun’s face dropped as he read the email he had just been sent. Cursing under his breath, the man pushed away from his desk and poked his head out the door.
“Hayoung,” he said. The woman at the desk looked up at him and from the look on her face, she knew what he was going to ask.
“Sir, I’m so sorry…” and she truly did sound sincere. “Gongmyung had no other times available to meet. He’s leaving for London tomorrow morning.”
Jaehyun pursed his lips as he nodded. He felt awful that he couldn't take Subin out tonight, but he had one idea that could make his daughter feel better.
The man checked the watch on his wrist, reading the time as 5:30pm. If he left now, Jaehyun could be at Subin’s school for 6:15pm to pick her up from daycare, talk to her, and bring her home for 6:45pm before he had leave the house by 7:30 to be back at the office for 8:00 pm to meet the clients for dinner.
“Alright, I have to leave now, but I’ll be back in time for the meeting.” Hayoung looked as if she was going to object, but instead she just nodded her head. Jaehyun grabbed his jacket from his office before pulling his phone out from his pocket. As he walked to the elevator, he scrolled through his contacts, searching for your name.
As Jaehyun stood, waiting for the elevator, his heart raced with both the urgency of the situation and the lingering nervousness he got when you spoke. His thumb hovered over the call button when he hesitated. He took a deep breath and leaned against the glass railing behind him, feeling a pang of worry gnaw at him. Would he be imposing on you once again?
The elevators hummed softly as they stopped at different floors of the building while Jaehyun debated with himself, the prospect of the impending meeting weighing heavily on his shoulders. He decided to call you, but not just for Subin’s sake, for his too.
“Hello?” Your voice on the other end had a certain warmth, and it sent a shiver down Jaehyun’s spine.
“Hey,” Jaehyun let out a sigh at the sound of your soft voice. His voice tinged with the tension that had been building in the pit of his stomach ever since he received that email.
“What’s wrong? You sound stressed.” You grew concerned when you realised how his voice was quieter than usual.
“It’s just work stuff…” Jaehyun’s shoulders slumped. “I really hate to ask you this,” And he really did. “I was wondering if you could watch Subin tonight? I know it’s Halloween, and it’s super last minute, but I was just scheduled for a meeting, and you’re the only one she’d want to go with.” the disparity in his voice ran deep, but you didn’t have any plans anyways, so why not?
“Of course, Jae.” You said, and the man sighed with relief. “What did she dress up as for school?” The calmness in your voice soothed Jaehyun’s nerves. The elevator sounded as it arrived. After the doors opened, Jaehyun entered and leaned against the wall as he felt a strange mix of emotions.
“She decided she was going to be Elsa and when we went trick or treating, she wanted me to be Anna.” There was a moment of silence, but Jaehyun already knew what was about to happen. As the man closed his eyes momentarily, you burst out laughing on the other line.
“You were really going to dress up as Anna for her?” you asked, your voice was laced with amusement that made Jaehyun chuckle.
“It was either that or Quasimodo from the Hunchback of Notre Dame.” A hand ran over Jaehyun’s face in embarrassment, remembering the conversation he had with his seven year old daughter last month when they were discussing costume ideas.
“What, did she want to be Esmerelda?” you asked with a scoff.
“No, she wanted to be Laverne.” Jaehyun groaned, wondering from whom his daughter gets her ideas from.
“The gargoyle?” you cried. You held the phone away from your ear as you laughed loudly, clutching your stomach.
“Yeah,” the man replied, looking at his shoes with a smile, the sound of your laughter resonating with him. “How much do you want me to pay you?” he asked as he walked out the elevator and to the entryway of the building. He waved to the secretaries and to those who greeted him with a smile.
You tried to reason with him, arguing that you didn’t need the extra compensation, but Jaehyun’s insistence on repaying your kindness only heightened the nagging tensions between the two of you.
“Jae, you really don’t have to, you know I’d do anything for you guys.” Your voice was gentle, “You know I feel bad asking you to watch her without paying you.” Jaehyun’s voice dropped lower, carrying an undertone of a deeper emotion with it.
As he exited the building, silently thanking the valet driver for his keys.
“But I’m telling you that you don’t have to.”
Your attempt to reason with him was met with Jaehyun’s unwavering determination. “We’ll talk about it later.”
With no room for further discussion, you conceded, “I’ll see you at seven, then.”
“I’ll see you then.” Jaehyun confirmed, the tension settled down thickly in the air.
“Bye, Jae.” You said softly.
“Bye, y/n.” Jaehyun replied, the sudden strain in his voice giving way to a sense of longing as he entered his car.
Sitting in the driver’s seat, Jaehyun gripped the steering wheel and looked down, feeling a slight strain in his pants. “Jesus fucking Christ…” the man muttered. “What am I, twelve?” his head fell back against the headrest in frustration.
Jaehyun rolled down the window before he began to drive, in hopes that the cold breeze would clear his mind of the thought of you, and focus on what was more important: trying to find a way to tell Subin that he can’t take her trick or treating.
-
By the time Jaehyun had parked in the school parking lot, he had nothing. He still didn’t know how to tell his daughter the news. Taking a deep breath, Jaehyun pushed open the car door and got out of the vehicle before locking it and heading to the waiting area.
Minutes later, the bell rang and children of all ages flooded out the doors. Jaehyun stood amidst the sea of children pouring out of the school, his eyes scanning the crowd for a familiar little girl in an Elsa costume. He spotted her soon enough, her blonde wig glistening in the autumn sun, and a smile spread across his face. Subin was chatting excitedly with her friends, and he knew he had to break the news gently.
He approached her, kneeling down to her eye level. “Hey, princess,” he greeted her with a warm smile.
Subin’s face lit up at the sight of her father. “Daddy!” she squeaked and launched herself into his arms. Jaehyun laughed as he almost stumbled onto the floor, but his arms wrapped around his daughter tightly.
“Come on, let’s get you to the car.” Jaehyun stood up carefully with his daughter still in his arms. As he walked, Jaehyun sucked in a deep breath before he told his daughter the bad news. “Subin, about tonight…”
The girl looked up at him with curious eyes. “What is it, Daddy?”
Jaehyun cleared his throat, trying to find the right words. “Well, I know how much you were looking forward to trick or treating tonight, and I was really excited too, but something came up at word.” He paused, gauging her reaction.
Subin’s smile faded, and her brows furrowed. “Do you have a meeting tonight, Daddy?”
Jaehyun’s heart felt like it was breaking off piece by piece. “I’m so sorry sweetheart, I tried to reschedule it for later, I really did, but it didn’t work out.” Jaehyun frowned, but his daughter smiled.
“It’s okay, Daddy. Do you think you’ll be back to watch HalloweenTown with me?”
“I’ll do my best, okay? I promise I’ll make it up to you sweetheart.” Jaehyun promises. “Until I come back home, I asked the lady from the floor below us to watch you, you remember her, right?”
“The pretty lady you invite over every weekend? I remember her.” Subin nodded, unaware of how red her fathers ears had turned.
“She doesn’t come over every weekend.” Jaehyun mumbled, looking away from his daughter as they arrived in front of the car.
“She does… Dohwa even asked me if she was my mom.”
“Oh…” he replied simply. Jaehyun stayed silent as he sat his daughter in the booster seat behind the passenger’s side, the thought almost consuming him.
Dohwa asked if she was her mom…
After he clicked her seatbelt in, Jaehyun shut the door and headed for the driver’s seat, still entirely thinking of you… as a mother…
The man paused right as he was about to open the door when he felt the same stiffness from earlier, and he had to stop himself from screaming curses at the sky. Jaehyun closed his eyes and swallowed harshly before he opened his eyes and entered the car like nothing had happened to him.
“Daddy, can we listen…”
“Of course,” Jaehyun gave his daughter a smile through the rearview mirror. He knew exactly what the kid was asking for, and with a few presses of some buttons, the intro of the infamous ‘Let it Go’ from the Frozen soundtrack was blasting from the speakers, and Subin was belting out the words.
The rest of the ride was filled with more Frozen, which consisted of duets, the respective solo’s of both Jaehyun and Subin, and the booing of Hans whenever he sang in Love is an Open Door.
Jaehyun had arrived at the condo building at 6:45pm, “Right on schedule,” he said to himself as he walked to the other side of the car to help his daughter out of the car. “Come on, sweetie,” he said, lifting her into his arms. With how adorable she was in her Elsa costume, he was determined to make it up to her for the missed trick or treating.
After a quick elevator ride, they reached his penthouse. The elegant, modern space was impeccably decorated, a reflection of Jaehyun’s refined taste.
“What d’ya want to eat before the pretty lady gets here, Miss Elsa?” Jaehyun asks Subin, who was already halfway to the kitchen. He followed behind her and held the door open for her as she entered. “Goldfish…” she said hungrily, causing a laugh to escape from Jaehyun’s lips.
“Goldfish it is, then.” The man took a bowl from one of the cabinet’s before he scanned his pantry for the snack that was requested. While Jaehyun looked, he heard Subin squeal with excitement. A mix of confusion and concern churned through Jaehyun, so he tried to be quick with his search and found them on the top shelf.
“Subin, I found them…” Jaehyun stopped in his tracks when his eyes found yours.
“Hey Jae,” you smiled, your insides twisting at his current state. He’d come from the office, you knew that already, but seeing him in that suit definitely messed with you a bit.
“Hey,” Jaehyun couldn’t help the way his heart raced at the mere sight of you. You were holding a neatly folded Anna costume in your arms, and the smile you gave him made his heart skip a beat. “You’re early.” he said. Although he looked quite distracted, Jaehyun still managed to pour Subin her goldfish and hand the bowl to her.
“Yeah, I just thought I’d come by a little early to see if Subin needed help with her costume.” Your innocence warmed Jaehyun and forced a smile onto his lips.
“That’s really thoughtful, thank you.’
“Don’t even mention it.” you said.
“Pretty lady, are you going to put your costume on now?” Subin interjected while she munched on the small crackers.
Jaehyun shuddered lightly, realising his daughter had just watched that whole interaction, even though she probably didn’t register what was going on.
At least that’s what you both hoped.
“Oh! Yes, yes, I will go do that. So, give me a few minutes, yeah?” you winked at her which earned you a big grin from the little girl.
“You can change in the guest bathroom.” Jaehyun blurts. “I’ll show you where it is.”
“Yeah, yeah, sounds good.”
Jaehyun walked out first, but it didn’t take long for you to catch up to him. You walked silently up the stairs and down the hall until you reached the room.
“Let me know if you need anything,” he said.
You thank him before you enter the bathroom, one you’ve definitely seen before. You set the costume down on the counter and begin to undress. Everything was going well until it came down to actually doing up the back of the dress.
“Jaehyun?” you raised your voice ever so slightly, just to check if he was still there, and in a heartbeat there was a soft knock on the door.
“You called?” His voice was a bit muffled from being on the other side of the door, but you opened the door, finding him leaning against the door frame.
“Could you help me with this?” you asked with a hand across your chest to keep your dress from falling.
Jaehyun looked away from your eyes, suddenly feeling very warm in the face and ears. “Yeah, could I come in?”
You moved so he had room to enter, and you shut the door almost immediately after and locked the door. Your back was facing Jaehyun, but you were watching him through the mirror. You felt bold until his dark eyes met yours in the reflection, and since then, his gaze didn’t leave yours.His heart raced as he looked into your eyes, and his fingers trembled slightly as he began to tie the strings at the back of your dress.
The tension in the air only grew stronger as his fingers brushed lightly against your skin, and your breath hitched. You couldn’t help but steal a glance over your shoulder, meeting Jaehyun’s gaze once again.
“Done…” he gulped, holding your stare. It was a moment where words were no longer necessary, and the attraction between you two was undeniable.
Jaehyun leaned in closer, his lips brushed against the nape of your neck. Your heart raced, and you tilted your head slightly, granting him access to your skin. His kisses were gentle, sending shivers down your spine, and his arms which had wrapped around your waist, had become your new form of support.
As he continued to trail soft, lingering kisses along your neck, Jaehyun whispered, “You’re making it hard for me to focus on anything other than you.”
You turn around to face him, your lips dangerously close to his. “Maybe that’s the point,” you replied with a mischievous glint in your eyes.
With a surge of longing, Jaehyun closed the small distance between your lips and his. The kiss was passionate and electric, and yet still so familiar from the previous ones you’ve shared from almost every weekend for the past three months.
One of Jaehyun’s hands cupped your cheek as the other snaked down to your waist, pulling you in closer. He felt the heat of your body merge with his, and his heart raced as he deepened the kiss. Your hands were tangled in his hair, and the taste of his lips sent a wave of euphoria through your body.
Jaehyun pulled away, but only slightly. His forehead was still pressed against yours, and he whispered, "I could kiss you like this forever."
Your lips curled into a small smile and you replied, "I wouldn't mind it."
With that, Jaehyun kissed you again, and this time it was more desperate, more passionate. He moved his lips hungrily against yours, exploring and tasting your mouth. You let out a soft moan as his hands moved to your lower back, and your kiss became more passionate.
His hands moved to the small of your back, and he lifted you up, your legs wrapping around his waist. You felt the warmth of his body against yours, and you melted into his embrace.
He carried you to the counter, and sat you down on the cold marble, and your arms tightly wrapped around him. You could feel his heart pounding against your chest, and the intensity of the kiss was enough to make your head spin. You felt like you were in some kind of trance, and you welcomed it with all your heart.
With his hips in between your legs, you reached out your hand to palm his growing erection through his pants. Jaehyun pulled away from the kiss, letting his head fall back in pleasure.
“God, baby, I got hard twice today because of you.” You hummed in response, slowly undoing Jaehyun’s belt and freeing his cock from his boxers. Bringing your hand to your mouth, you spit into it before lubing up his dick with it.
You started to move your hand up and down, slowly stroking his shaft and Jaehyun let out a low moan. His eyes were closed and he was breathing heavily, his hips starting to move in time with your hand.
Your hand closed over the tip, stroking it in circular motions before you moved your hand to jerk off the rest of his length. You increased the speed of your hand, Jaehyun's breathing getting heavier with each stroke. You could feel how hard he had gotten, and you smiled as you continued to pleasure him. Feeling your spit start to dry up, you started to use more of your hand, your fingers tracing circles around the head of his cock. Jaehyun's hands were gripping the material of your costume tightly, and you could feel his hips twitching with each of your strokes.
You moved your hand faster, your thumb now rubbing circles around Jaehyun's most sensitive spot, and he let out a loud moan as he was about to cum, but before he could, a timer went off.
“Fucking christ,” You both sighed out of disappointment, and Jaehyun rested his forehead against yours.
"I have to go," he said, regretfully. He quickly fixed himself up and helped you off the counter.
“What if you’re still hard during your meeting, though?” You joke while your fingers toyed with his belt loops.
He chuckled, and kissed you one last time before reluctantly pulling away.
“I’ll figure something out." You pouted, and he leaned in to give you one last peck on the lips before he grabbed his phone and unlocked the door. "I'll see you soon. I promise." He said before slipping out of the door.
You sighed and smiled to yourself, savouring the moment. You felt more alive than ever.
Sliding off the counter, you turned and inspected your face to make sure you didn’t go back to Subin looking like a hot mess.
“Pretty lady!” Subin yelled as you walked down the stairs. The young girl squealed as she ran to wait for you at the edge of the steps. She gushed at you once you had fully arrived in front of you. “You look so pretty!”
“Thank you sweetheart.” you said as you ruffled her hair. “Ready to go?” you asked her with a grin. Subin nodded frantically and grabbed your hand before she darted towards the elevator, her candy bag in the other hand waiting to be filled to the brim with treats.
“Trick or treating!” she cheered and jumped with excitement, and your heart warmed at the sight.
-
“Thank you so much for your time Gongmyung.” Jaehyun smiled as he shook the older man's hand.
“Of course! The pitch was great, so our lawyers will be in contact with yours very shortly.”
Jaehyun saw the man out of the smile and one final bow before he looked down at his watch. It was 9:30pm.
‘They should be home by now.’ Jaehyun thought as he got in his car and began to drive home.
It only took him about twenty minutes to get home from the restaurant, and by the time he reached the penthouse, he found you sitting on the couch with his daughter sleeping peacefully next to you, her head resting on your thigh.
“Hey,” you smiled up at him. Jaehyun mirrored your expression as he sat down next to you and wrapped an arm around your shoulders.
“When did she pass out?” Jaehyun’s fingers drew circles against your arm as you leaned into him.
“About an hour ago? She already brushed her teeth, we were just watching The Nightmare Before Christmas.” Jaehyun looked at you, his brows scrunched closer together.
“Is that not a Christmas movie?”
“Tsk… no one knows what it is or isn’t.” you said, jutting out your bottom lip before Jaehyun pecked your cheek. “I think I’m gonna put Subin to bed… show me to her room?” You slowly moved in a way that wouldn’t disturb the little girl too badly, and you brought her to your chest and rested her head on your shoulder. Both you and Jaehyun stood and you cautiously walked up the stairs and down the hall.
Jaehyun opened the door, revealing a baby pink room with toys and stuffed animals astray.
“This room is so…”
“Scary?”
“Her,” you shot Jaehyun a dirty look which made him laugh. “Not too loud, idiot.” you scolded him when you felt Subin stir at the loud noise. Cradling her head, you ordered Jaehyun to pull her bed covers back. Gently, you set the girl down before tucking her in. You stepped back to watch Jaehyun crouch beside her head and plant a light kiss on forehead. He sat there for a few seconds, rubbing her cheek with his thumb. With one last peck goodnight, he got up and smiled softly at you before he took your hand in his and led you out of the room.
With the lights off in Subin’s room and her door shut, the two of you stood in the hallway, staring into each other’s eyes.
“Thank you, again, for watching her.” Jaehyun stepped closer to you. You noticed how his tone dropped, how his hands squeezed yours gently, and how his eyes flickered from your eyes to your lips.
“Like I’ve said, you don’t have to thank me… but you can show me your appreciation in a different way.” you teased and hooked your fingers around his belt loop like you did earlier.
Jaehyun smirked devilishly, leaning in to kiss your neck. His hands moved around your waist, dipping lower until he cupped your ass.
As he trailed kisses along your neck, he paused to nibble and suck on your sensitive skin. His hands moved up your back, tugging your hips even closer to his. You felt your own arousal growing as his lips moved from your neck to your lips, his tongue pushing its way into your mouth. You moaned against his lips as your hands found their way into his hair, fingers curling around the strands of his hair.
“We shouldn’t do this out here…” you said breathlessly, and Jaehyun groaned in agreement.
He pulled away and took your hand, leading you to the guest room. Your pulse was racing as he pushed open the door, and you both stepped inside. He pulled you close and kissed you deeply, while your hands moved to the back of his neck, tugging him in closer as your lips moved together in an urgent, passionate kiss. His hands travelled their way down your body, exploring your curves as you explored his. He trailed kisses down your neck, making you gasp as his teeth lightly grazed your skin. You groaned in pleasure as you felt his erection growing against your belly.
He grabbed your hair and pulled it back, his face hovering close to yours. "Tell me what you want," he growled.
You bit your lip and smiled, your desire rising with each passing second. You wrapped your arms around his neck and leaned in to whisper in his ear, "I need you to fuck me."
He groaned and pulled you closer, his hands roaming your body. His lips brushed against your ear as he responded in a chuckle, “Waited all day for you to say that to me.”
In an instant, Jaehyun brought you towards the bed, a fire raging in his eyes. You were both eager to get undressed, and you started with his shirt. You reached to undo the buttons of his suit and slowly started undoing them, never breaking away from his embrace. Jaehyun’s breaths were heavy and rushed as you finally released his shirt and pulled it off his body.
His hands moved to your shirt and he proceeded to do the same with you, slowly pulling your shirt off and tossing it aside. He grabbed your waist and pulled you closer, his lips finding yours again. His hands were frantic as they roamed your body, the intensity of his kiss growing with each passing moment.
He leaned back and pulled you with him, the two of you standing there in nothing but your underwear. His eyes were ablaze with desire and he stepped forward, pushing you back onto the bed. He leaned over you and slowly trailed his lips down your body, his hands massaging your curves as he made his way down.
He pulled back and looked into your eyes, his own filled with a primal hunger. With one hand, he grabbed your wrists and pinned them above your head, his lips finding yours again as the other hand found itself making its way down your navel, all the way to your pussy. His thumb took to your clit, drawing small circles on it.
The friction felt electric, you couldn’t help but shiver at his cold hands touching such sensitive parts. A soft moan escaped your lips as your hips involuntarily arched towards his touch. His thumb moved faster, increasing the intensity of the pleasure. You felt pleasure radiating through your body, slowly building to an unstoppable force. Your breathing became shallow, your heart raced, and all you could do was surrender to the sensations. His thumb began to move with more intensity, each circle growing wider and wider. His touch was gentle yet demanding, sending sparks of pleasure shooting through your veins. The hand that had your wrists in a tight grip suddenly let go, but it moved to your hip and he grabbed firmly, steadying you as his thumb continued to bring you closer to the edge.
You could feel his breath against your neck, his fingers digging into your hips as he moved them. Suddenly, he slapped you hard on your pussy and you gasped in surprise. The repeated action brought you close to tears. As your jaw hung open from a mix of surprise and pleasure, Jaehyun saw this as the perfect opportunity to do the thing you love. Hovering just slightly over your mouth, he let his saliva drop into your mouth, and he watched with a smirk as your jaw shut immediately, swallowing what he gave you.
His tongue soon found its way into your mouth, and you tasted the bitterness of his spit as it mingled with yours. His hands moved with purpose, sending waves of pleasure cascading through your body.
You could feel the anticipation building in your body, and you could barely contain the moans that escaped your lips. You were so close to the pinnacle of pleasure, and his touch was the only thing that could get you there.
“Fuck, Jae… oh fuck.” you said as a signal to him that you were cumming. If that didn’t tell him, then the way your body shook definitely did.
Not long after you came, Jaehyun sat himself in between your legs. Both of his hands moved to your thighs, pushing them apart as he knelt in front of you. He looked up at you with pure adoration and started to kiss and lick your inner thighs.
Jaehyun kept one arm around your hips while the other explored your pussy, fingering you slowly. You gasped and hissed in pleasure as he teased your sensitive areas. He moved his mouth to your pussy and started to lick and suck in a tantalising rhythm. His tongue moved in slow circles, alternating between soft and hard strokes.
The arm he kept around your wait found itself lazily dragging from your waist, up to your breasts. His nimble fingers squeezed and teased your nipples, not helping the fact that you were trying to keep your voice down– even though you were several rooms down from his daughter.
The back of your hand moved to cover your mouth as you moaned, while the other grabbed his head, pushing him deeper into you. He bit down on your labia and licked the sensitive skin around your clit, sending shockwaves of pleasure through your body. Jaehyun moved his fingers inside you, pushing them in and out in a steady rhythm, his thumb finding the spot that sent sensations of pleasure through your body.
He then began to massage your clit with his tongue, circling it slowly and then faster and faster until you felt your toes curl in anticipation. His hands moved down to your hips, holding you tightly as he increased the pressure and speed of his tongue.
You felt your muscles tensing and your breathing becoming more rapid as you got closer to the edge. His fingers moved faster and faster, stimulating you in all the right places. You moaned and gasped as your orgasm finally overcame you, your body shaking in pleasure.
“Came so quick.” Jaehyun stated, slowly moving his mouth back up to yours and kissed you passionately, his tongue exploring your mouth as his hands moved to your waist.
He grabbed your hips and spread your legs wider, pushing his hard cock inside of you. He moved slowly at first, letting out a guttural moan as he entered you.
He moved his hips in a circular motion, pushing himself deeper into you as he felt your tight walls stretching around his thickness. He felt as if he was being consumed by a blanket of pleasure, and he loved the feeling of being completely surrounded by you. With each movement, you could feel him stretching you out further, and the sensation made his body tremble with delight.
“Fuck, baby, you’re doing so fucking well.” His breathing quickened as he felt the sensation of being fully engulfed inside of you, and the sensation of pleasure coursing through his body. He felt as if he were melting into you, becoming one with you as he moved faster and faster.
He added a new layer of pleasure to his movements, as he sucked and licked on your nipples while he continued to thrust. His tongue felt like velvet on your skin, teasing and tantalising you with every movement. His hands moved to your back, caressing it with every thrust.
You grasped his shoulders tightly as the sensations built up inside, and you felt yourself getting closer and closer to the edge. Finally, you threw your head back and let out a loud moan as you reached your climax, your pleasure washing over you. Jaehyun’s breathing became heavier, and you could feel his muscles tense up, his whole body shaking with pleasure.
“Fuck baby…” Jaehyun groaned, looking down at your pussy. “You’re so fucking full.” he bit his lip to stop himself from showing his smile, but it was useless– Jaehyun was grinning from ear to ear with pride. He watched as his cum dripped out of you, but with two fingers, he took whatever had leaked and shoved it back into you.
“Hey,” you said, grabbing his attention with his fingers still inside of you. “You gonna fuck me full of your cum, or what?”
Jaehyun almost lost it. Asking that of him was not the smartest idea, considering the fact that he’d do anything you told him to.
“Is this you asking to have my second kid? We’re not even together.” He joked as he sat himself with his back against his headboard.
You knew what that meant.
Getting on your knees, you crawled on top of him and positioned yourself above his still very hard cock.
“I could do both…” you say without another thought.
“Oh baby,” he said, voice more seductive than you’ve heard before. “I’ll fuck you so hard, you’ll get pregnant right away.” And with that, he thrust upwards, shoving his thick cock into you.
You exclaimed in surprise, eyes going wide, but your hands flew to his shoulder, stabilising yourself as he moved inside of you. He moved long and slow, his hips rolling against yours, and you felt your pleasure building with each thrust. He reached down and grabbed your ass, squeezing the soft flesh as began to pick up his pace. His breathing became ragged as he went deeper and deeper into you.
His hands moved higher, gently caressing your breasts, his lips lightly sucking and licking them. His fingers moved lower, rubbing and teasing your clit, and his tongue licked and sucked your nipples.
“Fuck, just look at you, your fucking tits bouncing…” he mumbled, his mouth watering at the sight. “Gonna get you pregnant with my baby, and your tits are gonna be so fucking big.” Jaehyun moaned at the thought. You felt his tongue flick against your nipples, and you gasped in pleasure as he teased them with his mouth.
As he sucked on your nipples, Jaehyun started to pick up the pace, pushing himself in and out of you. His hips moved in a perfect rhythm, each thrust sending a wave of pleasure through your body. You felt your eyes roll to the back of your head, and your breath coming in ragged gasps.
You could feel the heat building inside you as he continued to move. His hand moved down, rubbing against your clit as he moved, sending pleasure coursing through your veins. His thrusts were getting harder, and faster, and you could feel yourself getting closer and closer to the edge.
Just then, he pulled out of you and flipped you over onto your back. He stared into your eyes, holding your gaze as he penetrated you again. “Fuck Jaehyun, I need your cum.” You whined. His thrusts were more forceful now, and you could feel yourself moaning louder and louder as he continued to move inside of you.
He then started to move one of his hands up and down your body, playing with your nipples and lightly caressing your breasts. His tongue lapped at them, and you felt your body tense up as he sucked on them. He moved the other hand down to your clit again, rubbing it in circles as he moved inside of you.
“Need to get you so fucking full.” Jaehyun spoke aimlessly as he fucked your cunt, his thrusts growing harsher by the second. You hummed at his words, equally as brainless as he was from the stimulation.
You felt yourself getting closer and closer to the edge, and Jaehyun increased his thrusts, pushing himself deeper inside of you. He grabbed your hips and held you tight, pushing himself deep inside of you. You screamed out in pleasure, your orgasm ripping through your body, and he followed shortly behind, his body shaking in pleasure.
His moans grew louder and his thrusts became more intense, the pleasure becoming too much for him to handle. He felt his orgasm build up inside of him, and as he reached the peak, he let out a cry of pure ecstasy. Jaehyun slowly pulled out of you before he laid beside you.
Turning to face him, you both lay there for a few moments, your breathing ragged and your hearts pounded in your chests.
“I meant what I said…” Jaehyun said, his thoughts now cleared from his prior state of mind. “About being together. The baby too, but that can come later.”
“I like that idea,” you hummed and pressed your lips to his.
˜”*°• *.* ˜”*°• ! nct u masterlist ! •°*”˜ *.* •°*”˜
——————————————————————————
| Headcanons |
Nothing Yet!
| Reactions |
Nothing Yet!
| Fake Texts |
Nothing Yet!
| Drabbles |
Nothing Yet!
| Series |
My NCT OT23 Halloween Collaboration (unfinished collab!)
| Timestamps |
Nothing Yet!
[ Taeyong Hard Thought ] -
18 + Content
Masterlist
I keep having Taeyong thoughts and it isn’t healthy. So just imagine if you were the inspiration behind ‘Baby don’t stop.’ I mean, what if it was something that occasionally slipped from your mouth when Taeyong was making you feel particularly good. (Stretching you out, fucking you just right, and why would you ever want him to stop, so you tell him a little breathlessly. He’s absolutely a pleaser, so he’ll carry on, maybe even go a little harder than before.) A few weeks later, Taeyong invites you into the studio so he can share some of the tracks he’s been working on with you. There will be a producer there too, but you’ve met them all enough times that they’re happy to have you there. One of the tracks in untitled and when Taeyong hits play, you’re very aware of his eyes on you, gauging your immediate reaction. When you hear Taeyong’s breathy ‘baby, don’t stop,’ you flush and look to the floor as if deep in thought, as if not trying desperately to avoid the producer’s eye because Taeyong had written a song baring some resemblance to you almost begging for him to fuck you. Taeyong certainly isn’t shameless so maybe he’s going to be a little flustered now he has you sat in front him listening to it, but then he sees you looking at him with bedroom eyes and it’s over, he’s ready to pull you away just so he can hear you say those words all over again.
Pairing: Johnny x AFAB Reader
Warnings: 18 + Content & Swearing, Nickname ‘Kid’
Masterlist
Johnny slowly tips his head in Mark’s direction as soon as the conversation about dating comes up as if it is a habit. You suppose that he really believes you’ll end up together eventually. He doesn’t tell you that it is Mark, always Mark and only Mark he points to because he doesn’t trust the other members of his group to not fall in love with you. Mark knows too much about him, about how he feels, to look at you in any way that isn’t friendship. But still, Johnny is unable to bring himself around to the idea of suggesting himself, as much as he wants to, as much as it pains him not to. So Mark is a safe alternative and he can continue playing the game, gently asking about your dating situation, before teasingly pointing out Mark as if it were the reason he asked in the first place.
The same thought passes through your mind on every occasion. Mark is just, well, Mark. He’s attractive, you can say that with some certainty. And sweet, and soft, with a mean streak you’re sure arises at just the right times. He really is everything anyone should ever want for in a relationship and sure, he’s one of your closest friends. But, he isn’t Johnny.
When you lift your eyebrows and shake your head, before diverting your attention to something else, the cycle begins again. Johnny does it all as if there isn’t a photograph of you tucked into his wallet, as if everyone does not know he is fighting off his feelings for you, except you. He watches as you turn away, he runs a hand through his hair and wonders how much longer he can continue like this, how much longer will you wait for him.
When it is time for Johnny to leave, he stands, ruffling a hand through your hair and the movement is a stark reminder of the invisible line that is drawn between you. He says, ‘Hey Kid, I’ll see you later.’
He leaves with a heaviness in his heart that has become uncomfortably familiar. He tries to keep himself in check, telling himself you’re a friend he cannot afford to lose. Just a friend who doesn’t know what she wants. As he walks through the hallway, he hears you laughing at something and he steels himself. Mark, it should be Mark.
It is three days later that he next sees you and it is three days too long. Between his busy schedule and your own, it is only when he finds a spare afternoon that he is able to invite you to tag along for coffee. You agree to meet outside the SM building, just as you have a million times before. As Johnny’s group slowly filter out from practice, he watches you through the glass, chatting to Haechan as if nothing in the world might disturb you. For a moment he wonders if he ought to nudge Haechan toward you, he’s a good one too and he would treat you just how you deserve. Something about the thought doesn’t sit right though and he quickly lets it go. He is faintly aware of Mark calling his name and he turns to meet him.
‘Johnny, come on,’ Mark sighs with a shake of his head and a smile, ‘Just ask her out man.’
Johnny sighs too. Before he can protest, Mark is holding the door for him and he follows him into the sunshine, hearing your laugh. When you walk along the street, the curling of Johnny’s arm around your waist is too natural to be comfortable and if he hadn’t done it a hundred times before, it would stir butterflies in your stomach.
At the coffeehouse, you insist on collecting the order from the countertop. Johnny’s line of sight follows you across the space, taking in the picture of you in the pretty periwinkle dress you save for when the weather is warm. He watches as the barista catches you in conversation and whilst you wait for the coffees, it is all laughter and friendly chatter. Johnny is familiar with the feeling that inches its way along his spine, pinning his shoulders. He wants to be angry with himself, how can he allow himself to feel such jealousy when he daren’t take the step he so wants to.
When you return to the table, taking three trips to carry the coffees, Johnny gestures to the barista left behind. ‘He seemed nice,’ he mutters, the cheeriness to his tone entirely fabricated.
‘Who?’ Is your reply, as if you hadn’t so much as noticed the guy, let alone his flirting.
Johnny’s laugh is genuine as he listens to you. ‘That guy. The one who just tried to get your number for fifteen minutes.’
‘Oh, right,’ You half-heartedly shrug, ‘Sure, he was.’
When Johnny glances at you, he realises that you are already looking at him. There is an almost unreadable expression across your face, but Johnny can almost read your mind, cursing him out for not making the move you’ve been silently begging for all this time. He shakes his head to dislodge the thought, ‘Not to worry Kid, there’s always someone else.’
Part of him wonders if he’ll ever push you far enough to confront him directly, but you brush off his comment with a soft smile and take a mouthful of your coffee. Just as the question of your dating situation, the moment falls away and Johnny is left with the same feeling of emptiness as before. As much as you laugh and lean together over the table, he is weighted by the simmering feeling that you aren’t really his.
After leaving the coffeehouse, he is insistent on walking you to your apartment building. He has an answer for every one of your protests - he doesn’t care that it is the middle of the day, that there are a hundred other people moving along the street. He isn’t ready to say goodbye yet. He doesn’t tell you that he might never forgive himself if he simply waves and watches you step into the crowd, he thinks someone might fall in love and whisk you away. So he carries your cardigan over his shoulder and his hand hovers over your waist whenever people brush by until you are nearly home.
He follows you into your apartment, grateful for the relief that the air-con provides. You immediately make for the refrigerator to pour two glasses of water and Johnny leans against the countertop. He’s told you a million times how much he likes your apartment and you can only suppose it’s because it is blissfully quiet in comparison to his shared bedroom with Haechan.
‘It’s so hot,’ Johnny sighs, peeling the back of his shirt from his skin. He goes to say something more but catches sight of the hem of your dress flitting dangerously high against the back of your legs as you reach upwards for a glass. The picture casts any thought from his mind.
He thinks back to the coffeehouse. Maybe it is because the city is sweltering, maybe the sight of an inch of extra skin, but he presses the matter. ‘That guy was into you, why don’t you give someone a chance?’
He hears you scoff as you hold a glass out to him, ‘I’m not dating Mark, Johnny.’
Johnny smiles at you, but his tone is serious, desperate. ‘I wasn’t going to suggest Mark. But, you know, you deserve to find someone.’
‘Johnny.’
The mention of his name is meant to serve as a warning, he knows and he stays quiet. As he watches you, he realises that you look tired, not physically, but tired of the sticky, complicated situation you share. He thinks about taking his leave, but you seem to read his mind and speak as to stop him.
‘Johnny, you know why.’
It is quiet again, save for the sounds filtering through the open kitchen window. Johnny meets your eyes and sees that your gaze is firm, unmoving, daring even. The expression is in contrast to your periwinkle dress, the laughter and the friendly affection he associates with you. He hears you acknowledge a million different moments all at once - the longing glances, the touches too familiar for friendship, the unspoken commitment to one another.
‘Kid,’ Johnny manages after a while, ‘You don’t know what you’re asking.’
Johnny is faintly aware of a shift in the atmosphere. He watches your easy-going manner twist into something more serious. The laughter that meets his ears is light and airy.
‘No, Johnny,’ You protest, turning away from him in the small space. ‘I do.’
He watches as you step away, putting a few extra paces between you, a hand running through your hair. He can see your pinned shoulders and hear the waver of your voice. After a moment, you turn and make for him and he wonders how long this has been brewing.
‘You always do this Johnny, call me Kid and push me away,’ the words are punctuated by the press of your finger into his chest.
Johnny looks to your face, but you seem unwilling to meet his eye. You are standing dangerously close. Your hand has fallen to your side in defeat and he can almost feel the heat burning across your cheeks, hot enough to cut through the summer air. He sighs heavily and for a second he panics the movement might cause you to flee, but you seem frozen. Slowly, cautiously, Johnny raises a hand to your cheek and gently guides you to look at him. He finally sees the tears that have gathered at the edges of your eyes and the sight causes his heart to lurch.
‘Kid,’ He murmurs, thumb softly moving over your skin. Your eyes are wide and waiting and Johnny sighs, ‘Fuck. I can’t break your heart.’
For a second you wonder if Johnny is going to do just that, whether you ought to have stuck with the silly unspoken game of before. But the sudden pull of his hand is slow, but firm, as if certain you might fly away if he lets go. His mouth is desperate against yours and strong and his other hand ghosts over your waist, bunching the material of your dress in his fingers. Before he can begin to question himself, you stumble forward until your chests are almost touching. It is a messy affair of clashing tongues and desperate fingers, at least until you break apart to catch your breath and then the reality of the situation seems to seep in. Johnny is standing closer than he has ever before, almost pressing you against the kitchen cabinet and his chest is lifting with each inhale of breath.
You force yourself to speak first, but only manage a quiet whisper of his name. Johnny winces, ‘Y/N, this isn’t how I wanted this to go.’
Johnny sighs when he feels your mouth barely scratch over his neck and he slowly guides you against the countertop. The press of his hips against your own is slow, giving you time to slip away if you want to. The soft noise of appreciation that escapes from your chest at the first experimental roll of his hips is enough for him to continue. His hand moves from your waist, trailing to the top of your thigh to feel the bare skin beneath your sundress and as he shifts, you’re able to feel the growing hardness beneath his jeans.
He is able to feel the lift of your mouth into a smile and he draws back to glance at your face. The smile across your features sends Johnny’s blood rushing southwards quicker than any amount of kissing and he finally allows himself to relax a little. Something about the seriousness of the earlier situation, of your firm tone and the sight of you moving away from him had set him on edge.
This time it is him who trails his mouth against the sensitive skin of your neck, relishing the sudden exhales of breath each nip of his teeth draws from your throat. He is conscious of your wandering fingers, slipping beneath the hem of his t-shirt, slowly moving against his abdomen, daring to shift beneath his belt buckle. As much as he wants you to continue, the feeling sobers him and he pulls himself away, the loss of contact elicits a whimper from you that almost fractures his resolve.
‘Y/N,’ Johnny smiles softly, his thumb tracing shapes on your hip, ‘I just don’t want to mess this up with you.’
His words cause your heart to flutter. If only you might tell him just how head over heels in love with him you are. ‘Johnny, I know. Why do you think I never said anything. I’d rather have you as a friend than not at all.’
Johnny’s smile grows a little wider. ‘Right. I just worry about you, about being with an idol and -.’
The gentle press of your hand against his chest breaks his train of thought. ‘Johnny, stop thinking.’
It is with something between adoration and absolute desire that he looks at you as you approach. He desperately tells himself to ingrain the image of you into his mind, standing in your kitchen, awash in the sunshine pouring through the window. Johnny’s hands reach for your waist and threaten to move beneath the hem of your dress and he is shameless as he presses himself against you. Your hands find purchase beneath his t-shirt, fingernails raking over his bare skin and it feels different touching Johnny like this, but better than you might have imagined.
Johnny is soft and gentle, letting you guide him to your bedroom by his hand. At the foot of your bed, you look at him in an unspoken plea and he silently takes control, pushing you toward the duvet before settling himself between your thighs. He moves slowly, but with great purpose - grazing his teeth beneath your ear, spreading his hand on your thigh and forcefully pressing his hips against your own. The press of your nails into his shoulder blade and the breathy whines leaving your mouth drive him on, pushing him to pull the t-shirt from his back. His fingers slip beneath the straps of your summer dress and as he fiddles with them he pauses, ‘We can stop at any point, Y/N.’
He hears your huff and feels the tug of your fingers against the ends of his hair. When he finally removes your dress, he sighs against your neck and you relish in the feeling of bare skin against bare skin. Johnny raises himself onto his hands to have himself a shameless glance of your figure, ‘Kid,’ he mutters, shaking his head with a smirk playing at the edges of his mouth.
He kisses along your stomach, on the inside of your thighs, dangerously close to your underwear. The movement riles you up exactly as he desires and he feels you fidget beneath him, whining his name. He hooks a finger beneath the waistband, but does not immediately move, giving you time to push him away, but you only stutter his name once more. Johnny is slow as he slips your underwear along your thighs, taking great enjoyment in the motion before he throws it to the side. He, at last, places his mouth where you most want him, smirking as he feels your hands move through his hair as his tongue flattens and rolls between your thighs, his breath fanning against your heat. His hand splays against your stomach to keep you in place and for a while, he is captivated by the sound of his name falling from your mouth and the tremble of your thighs.
Slowly, steadily, he draws you to the edge, responding to each pull of his hair and jerk of your hips, until your thighs shake against his shoulders. He only stops when your fingers slip to his jaw and gently pull him away and he finally takes in your appearance. Johnny knew you were beautiful, but something about the sight of you, wide-eyed and needy for him strikes something a little deeper. He is aware of your fingers scooting along his abdomen, fiddling with the buckle of his belt.
Johnny is big in every sense of the word - big as he nestles between your thighs, but even bigger when he lines himself up at your entrance. ‘Johnny,’ you mutter between kisses.
At the mention of his name, he looks to your face and pauses, faintly aware of how achingly hard he is against your thigh. You look at him with hooded eyes, ‘It’s been a while.’
At first, Johnny just nods, before he lets out a breathy chuckle and his head falls forward to your shoulder, ‘I guess that’s my fault.’
Your laughter is a firm reminder of just how much he wants this, how much he wants you, the sex and the laughter. When he starts to slip inside, slowly because he wants to take the utmost care of you, he can feel your nails pressing crescent shapes into his shoulder. Part of him thinks he ought to be worried about someone seeing them, part of him wants everyone to know that you’re his, maybe he’ll walk around the dorm shirtless just to show Haechan, Mark, and everyone, that you’re only his.
Johnny winces as he bottoms out, the feeling of you squeezing him making him want to curse himself for waiting so long to give in to his feelings. He furrows his brow and makes certain that you’re comfortable before he moves and you nod desperately, whilst pulling at his shoulders, searching for something to ground yourself with. Johnny smirks against your skin, moving with a little more force, reaching so deep that it feels as though he’s rearranging your insides. The feeling is so overwhelming that Johnny’s name falls from your mouth over and over again whilst you helplessly hold onto him.
It is quiet as you finish, Johnny’s thumb tracing over your cheek, his breath fanning against your neck and he is slow to move away. He shifts to lie on his back and pulls you close, resting your chin on his chest as his fingers trail along the skin of your back. ‘Hey, Y/N,’ he murmurs, drawing your attention to his face, ‘Can I take you on a proper date tomorrow? Wine and dine, even though we’ve done things out of order.’
Johnny’s heart tightens at the sincerity behind your smile. There is a pause before you sigh, ‘I was actually thinking of asking Mark out tomorrow.’
Johnny immediately groans and fidgets beneath you, pressing his fingers into his eyes. ‘You’re never going to let me live that down, are you?’
Whilst you shake your head just to agonise him a little more, the sound of your laughter is enough - he can take a lifetime of teasing if it means he can grow old hearing it.